Names & Taxonomy
- Uniprot ID:
- Q02643
- Entry Name:
- GHRHR_HUMAN
- Status:
- reviewed
- Protein Names:
- Growth hormone-releasing hormone receptor (GHRH receptor) (Growth hormone-releasing factor receptor) (GRF receptor) (GRFR)
- Gene Names:
- GHRHR
- Gene Names Primary:
- GHRHR
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 423
- Sequence:
- MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLTSMC
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane; Multi-pass membrane protein.
Function
- Function:
- Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion.
- Cross Reference Drug Bank:
- DB00010 DB08869
- Gene Ontology Go:
- cell surface
cytoplasm
integral component of membrane
nuclear inner membrane
nuclear matrix
nuclear outer membrane
plasma membrane
sarcolemma
secretory granule
G-protein coupled receptor activity
growth factor binding
growth hormone-releasing hormone receptor activity
peptide hormone binding
activation of adenylate cyclase activity
adenylate cyclase-activating G-protein coupled receptor signaling pathway
cAMP-mediated signaling
cell maturation
cell surface receptor signaling pathway
cellular response to glucose stimulus
cellular response to insulin stimulus
determination of adult lifespan
growth hormone secretion
hormone metabolic process
lactation
multicellular organismal reproductive process
positive regulation of cAMP biosynthetic process
positive regulation of cell proliferation
positive regulation of circadian sleep/wake cycle, non-REM sleep
positive regulation of growth hormone secretion
positive regulation of insulin-like growth factor receptor signaling pathway
positive regulation of multicellular organism growth
regulation of intracellular steroid hormone receptor signaling pathway
regulation of protein metabolic process
response to estrogen
response to glucocorticoid
response to insulin
somatotropin secreting cell development
water homeostasis - Gene Ontology Biological Process:
- activation of adenylate cyclase activity
adenylate cyclase-activating G-protein coupled receptor signaling pathway
cAMP-mediated signaling
cell maturation
cell surface receptor signaling pathway
cellular response to glucose stimulus
cellular response to insulin stimulus
determination of adult lifespan
growth hormone secretion
hormone metabolic process
lactation
multicellular organismal reproductive process
positive regulation of cAMP biosynthetic process
positive regulation of cell proliferation
positive regulation of circadian sleep/wake cycle, non-REM sleep
positive regulation of growth hormone secretion
positive regulation of insulin-like growth factor receptor signaling pathway
positive regulation of multicellular organism growth
regulation of intracellular steroid hormone receptor signaling pathway
regulation of protein metabolic process
response to estrogen
response to glucocorticoid
response to insulin
somatotropin secreting cell development
water homeostasis - Gene Ontology Molecular Function:
- G-protein coupled receptor activity
growth factor binding
growth hormone-releasing hormone receptor activity
peptide hormone binding - Gene Ontology Cellular Component:
- cell surface
cytoplasm
integral component of membrane
nuclear inner membrane
nuclear matrix
nuclear outer membrane
plasma membrane
sarcolemma
secretory granule - Keywords:
- 3D-structure
Cell membrane
Complete proteome
Disease mutation
Disulfide bond
Dwarfism
G-protein coupled receptor
Glycoprotein
Membrane
Polymorphism
Receptor
Reference proteome
Signal
Transducer
Transmembrane
Transmembrane helix