Names & Taxonomy
- Uniprot ID:
- P37088
- Entry Name:
- SCNNA_HUMAN
- Status:
- reviewed
- Protein Names:
- Amiloride-sensitive sodium channel subunit alpha (Alpha-NaCH) (Epithelial Na(+) channel subunit alpha) (Alpha-ENaC) (ENaCA) (Nonvoltage-gated sodium channel 1 subunit alpha) (SCNEA)
- Gene Names:
- SCNN1A SCNN1
- Gene Names Primary:
- SCNN1A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 669
- Sequence:
- MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIEFHRSYRELFEFFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYWQFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Apical cell membrane
Function
- Function:
- Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
- Enzyme Regulation:
- ENZYME REGULATION: Activated by WNK1, WNK2, WNK3 and WNK4.
- Cross Reference Drug Bank:
- DB00594 DB00384
- Gene Ontology Go:
- apical plasma membrane
ciliary membrane
cortical actin cytoskeleton
extracellular exosome
integral component of plasma membrane
motile cilium
plasma membrane
sodium channel complex
ligand-gated sodium channel activity
WW domain binding
ion transmembrane transport
multicellular organismal water homeostasis
response to stimulus
sensory perception of taste
sodium ion homeostasis
sodium ion transmembrane transport
transmembrane transport - Gene Ontology Biological Process:
- ion transmembrane transport
multicellular organismal water homeostasis
response to stimulus
sensory perception of taste
sodium ion homeostasis
sodium ion transmembrane transport
transmembrane transport - Gene Ontology Molecular Function:
- ligand-gated sodium channel activity
WW domain binding - Gene Ontology Cellular Component:
- apical plasma membrane
ciliary membrane
cortical actin cytoskeleton
extracellular exosome
integral component of plasma membrane
motile cilium
plasma membrane
sodium channel complex - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Cell projection
Complete proteome
Disease mutation
Glycoprotein
Ion channel
Ion transport
Membrane
Polymorphism
Reference proteome
Sensory transduction
Sodium
Sodium channel
Sodium transport
Taste
Transmembrane
Transmembrane helix
Transport
Ubl conjugation - Interacts With:
- P51170