Names & Taxonomy
- Uniprot ID:
- P28335
- Entry Name:
- 5HT2C_HUMAN
- Status:
- reviewed
- Protein Names:
- 5-hydroxytryptamine receptor 2C (5-HT-2C) (5-HT2C) (5-HTR2C) (5-hydroxytryptamine receptor 1C) (5-HT-1C) (5-HT1C) (Serotonin receptor 2C)
- Gene Names:
- HTR2C HTR1C
- Gene Names Primary:
- HTR2C
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 458
- Sequence:
- MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis.
- Cross Reference Drug Bank:
- DB06594 DB00321 DB00543 DB00714 DB01238 DB06216 DB01200 DB00248 DB09014 DB00477 DB01239 DB01242 DB00363 DB00434 DB01151 DB01191 DB01142 DB01049 DB00696 DB00458 DB01221 DB00589 DB04871 DB00408 DB00934 DB01403 DB00247 DB06148 DB00805 DB00370 DB01149 DB00540 DB00334 DB01267 DB01186 DB00413 DB00420 DB00777 DB01224 DB00734 DB00268 DB06144 DB00193 DB00656 DB00726 DB01392 DB00246
- Gene Ontology Go:
- cytosol
integral component of plasma membrane
plasma membrane
1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding
drug binding
G-protein coupled serotonin receptor activity
Gq/11-coupled serotonin receptor activity
serotonin binding
behavioral fear response
cellular calcium ion homeostasis
cGMP biosynthetic process
feeding behavior
locomotory behavior
phospholipase C-activating G-protein coupled receptor signaling pathway
phospholipase C-activating serotonin receptor signaling pathway
positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
positive regulation of ERK1 and ERK2 cascade
positive regulation of fat cell differentiation
positive regulation of phosphatidylinositol biosynthetic process
regulation of appetite
regulation of corticotropin-releasing hormone secretion
regulation of neurological system process
release of sequestered calcium ion into cytosol
response to drug
serotonin receptor signaling pathway
synaptic transmission - Gene Ontology Biological Process:
- behavioral fear response
cellular calcium ion homeostasis
cGMP biosynthetic process
feeding behavior
locomotory behavior
phospholipase C-activating G-protein coupled receptor signaling pathway
phospholipase C-activating serotonin receptor signaling pathway
positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
positive regulation of ERK1 and ERK2 cascade
positive regulation of fat cell differentiation
positive regulation of phosphatidylinositol biosynthetic process
regulation of appetite
regulation of corticotropin-releasing hormone secretion
regulation of neurological system process
release of sequestered calcium ion into cytosol
response to drug
serotonin receptor signaling pathway
synaptic transmission - Gene Ontology Molecular Function:
- 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding
drug binding
G-protein coupled serotonin receptor activity
Gq/11-coupled serotonin receptor activity
serotonin binding - Gene Ontology Cellular Component:
- cytosol
integral component of plasma membrane
plasma membrane - Keywords:
- Alternative splicing
Behavior
Cell membrane
Complete proteome
Disulfide bond
G-protein coupled receptor
Glycoprotein
Membrane
Polymorphism
RNA editing
Receptor
Reference proteome
Signal
Transducer
Transmembrane
Transmembrane helix