Names & Taxonomy
- Uniprot ID:
- P15538
- Entry Name:
- C11B1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome P450 11B1, mitochondrial (CYPXIB1) (Cytochrome P-450c11) (Cytochrome P450C11) (Steroid 11-beta-hydroxylase) (EC 1.14.15.4)
- Gene Names:
- CYP11B1 S11BH
- Gene Names Primary:
- CYP11B1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 503
- Sequence:
- MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion membrane.
Function
- Function:
- Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB.
- Catalytic Activity:
- A steroid + 2 reduced adrenodoxin + O(2) + 2 H(+) = an 11-beta- hydroxysteroid + 2 oxidized adrenodoxin + H(2)O.
- Cofactor:
- COFACTOR: Name=heme; Xref=ChEBI:CHEBI:30413;
- Cross Reference Drug Bank:
- DB00501 DB00257 DB00292 DB00196 DB00741 DB01026 DB01233 DB01011 DB01110 DB00648 DB00252 DB00421
- Gene Ontology Go:
- mitochondrial inner membrane
mitochondrion
corticosterone 18-monooxygenase activity
heme binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
steroid 11-beta-monooxygenase activity
aldosterone biosynthetic process
C21-steroid hormone biosynthetic process
cellular response to hormone stimulus
cellular response to peptide hormone stimulus
cellular response to potassium ion
cholesterol metabolic process
cortisol biosynthetic process
glucocorticoid biosynthetic process
glucose homeostasis
immune response
regulation of blood pressure
secondary metabolite biosynthetic process
small molecule metabolic process
steroid metabolic process
sterol metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- aldosterone biosynthetic process
C21-steroid hormone biosynthetic process
cellular response to hormone stimulus
cellular response to peptide hormone stimulus
cellular response to potassium ion
cholesterol metabolic process
cortisol biosynthetic process
glucocorticoid biosynthetic process
glucose homeostasis
immune response
regulation of blood pressure
secondary metabolite biosynthetic process
small molecule metabolic process
steroid metabolic process
sterol metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- corticosterone 18-monooxygenase activity
heme binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
steroid 11-beta-monooxygenase activity - Gene Ontology Cellular Component:
- mitochondrial inner membrane
mitochondrion - Keywords:
- Alternative splicing
Complete proteome
Congenital adrenal hyperplasia
Direct protein sequencing
Disease mutation
Heme
Iron
Lipid metabolism
Membrane
Metal-binding
Mitochondrion
Monooxygenase
Oxidoreductase
Polymorphism
Reference proteome
Steroid metabolism
Steroidogenesis
Transit peptide