Names & Taxonomy
- Uniprot ID:
- P63151
- Entry Name:
- 2ABA_HUMAN
- Status:
- reviewed
- Protein Names:
- Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PP2A subunit B isoform B55-alpha) (PP2A subunit B isoform PR55-alpha) (PP2A subunit B isoform R2-alpha) (PP2A subunit B isoform alpha)
- Gene Names:
- PPP2R2A
- Gene Names Primary:
- PPP2R2A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 447
- Sequence:
- MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
- Proteomes:
- UP000005640
Function
- Function:
- The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
- Gene Ontology Go:
- cytosol
nucleoplasm
protein phosphatase type 2A complex
protein phosphatase type 2A regulator activity
protein serine/threonine phosphatase activity
G2/M transition of mitotic cell cycle
gene expression
mitotic cell cycle
mitotic nuclear envelope reassembly
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
protein dephosphorylation
regulation of protein phosphatase type 2A activity
response to morphine - Gene Ontology Biological Process:
- G2/M transition of mitotic cell cycle
gene expression
mitotic cell cycle
mitotic nuclear envelope reassembly
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
protein dephosphorylation
regulation of protein phosphatase type 2A activity
response to morphine - Gene Ontology Molecular Function:
- protein phosphatase type 2A regulator activity
protein serine/threonine phosphatase activity - Gene Ontology Cellular Component:
- cytosol
nucleoplasm
protein phosphatase type 2A complex - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Complete proteome
Reference proteome
Repeat
WD repeat - Interacts With:
- P30153; P30154