Names & Taxonomy
- Uniprot ID:
- P56706
- Entry Name:
- WNT7B_HUMAN
- Status:
- reviewed
- Protein Names:
- Protein Wnt-7b
- Gene Names:
- WNT7B
- Gene Names Primary:
- WNT7B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 349
- Sequence:
- MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space, extracellular matrix.
Function
- Function:
- Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity).
- Gene Ontology Go:
- endocytic vesicle membrane
endoplasmic reticulum lumen
extracellular exosome
extracellular region
extracellular space
Golgi lumen
plasma membrane
proteinaceous extracellular matrix
frizzled binding
canonical Wnt signaling pathway
cell fate commitment
cellular metabolic process
cellular response to retinoic acid
central nervous system vasculogenesis
chorio-allantoic fusion
developmental growth involved in morphogenesis
embryonic organ development
embryonic placenta morphogenesis
establishment or maintenance of polarity of embryonic epithelium
fibroblast proliferation
forebrain regionalization
homeostatic process
in utero embryonic development
inner medullary collecting duct development
lens fiber cell development
lobar bronchus development
lung development
lung epithelium development
lung morphogenesis
mammary gland epithelium development
metanephric collecting duct development
metanephric epithelium development
metanephric loop of Henle development
metanephros morphogenesis
neuron differentiation
outer medullary collecting duct development
oxygen homeostasis
positive regulation of osteoblast differentiation
renal inner medulla development
renal outer medulla development
stem cell proliferation
synapse organization
trachea cartilage morphogenesis
Wnt signaling pathway - Gene Ontology Biological Process:
- canonical Wnt signaling pathway
cell fate commitment
cellular metabolic process
cellular response to retinoic acid
central nervous system vasculogenesis
chorio-allantoic fusion
developmental growth involved in morphogenesis
embryonic organ development
embryonic placenta morphogenesis
establishment or maintenance of polarity of embryonic epithelium
fibroblast proliferation
forebrain regionalization
homeostatic process
inner medullary collecting duct development
in utero embryonic development
lens fiber cell development
lobar bronchus development
lung development
lung epithelium development
lung morphogenesis
mammary gland epithelium development
metanephric collecting duct development
metanephric epithelium development
metanephric loop of Henle development
metanephros morphogenesis
neuron differentiation
outer medullary collecting duct development
oxygen homeostasis
positive regulation of osteoblast differentiation
renal inner medulla development
renal outer medulla development
stem cell proliferation
synapse organization
trachea cartilage morphogenesis
Wnt signaling pathway - Gene Ontology Molecular Function:
- frizzled binding
- Gene Ontology Cellular Component:
- endocytic vesicle membrane
endoplasmic reticulum lumen
extracellular exosome
extracellular region
extracellular space
Golgi lumen
plasma membrane
proteinaceous extracellular matrix - Keywords:
- Complete proteome
Developmental protein
Disulfide bond
Extracellular matrix
Glycoprotein
Lipoprotein
Reference proteome
Secreted
Signal
Wnt signaling pathway