Names & Taxonomy
- Uniprot ID:
- P18847
- Entry Name:
- ATF3_HUMAN
- Status:
- reviewed
- Protein Names:
- Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3)
- Gene Names:
- ATF3
- Gene Names Primary:
- ATF3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 181
- Sequence:
- MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus
Function
- Function:
- This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
- Cross Reference Drug Bank:
- DB00852
- Gene Ontology Go:
- CHOP-ATF3 complex
nucleolus
nucleoplasm
nucleus
identical protein binding
protein heterodimerization activity
protein homodimerization activity
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II regulatory region sequence-specific DNA binding
transcription corepressor activity
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
transcription regulatory region DNA binding
transcription regulatory region sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
cellular protein metabolic process
cellular response to amino acid starvation
endoplasmic reticulum unfolded protein response
gluconeogenesis
negative regulation of ERK1 and ERK2 cascade
negative regulation of transcription from RNA polymerase II promoter
PERK-mediated unfolded protein response
positive regulation of cell proliferation
positive regulation of TRAIL-activated apoptotic signaling pathway
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance
skeletal muscle cell differentiation
transcription from RNA polymerase II promoter - Gene Ontology Biological Process:
- cellular protein metabolic process
cellular response to amino acid starvation
endoplasmic reticulum unfolded protein response
gluconeogenesis
negative regulation of ERK1 and ERK2 cascade
negative regulation of transcription from RNA polymerase II promoter
PERK-mediated unfolded protein response
positive regulation of cell proliferation
positive regulation of TRAIL-activated apoptotic signaling pathway
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance
skeletal muscle cell differentiation
transcription from RNA polymerase II promoter - Gene Ontology Molecular Function:
- identical protein binding
protein heterodimerization activity
protein homodimerization activity
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II regulatory region sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription corepressor activity
transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
transcription regulatory region DNA binding
transcription regulatory region sequence-specific DNA binding - Gene Ontology Cellular Component:
- CHOP-ATF3 complex
nucleolus
nucleoplasm
nucleus - Keywords:
- Alternative splicing
Complete proteome
DNA-binding
Nucleus
Polymorphism
Reference proteome
Repressor
Transcription
Transcription regulation - Interacts With:
- Itself; P15336; P18848; P17544; Q9NR55; P53567; P35638; Q14192; P05412; P17275; P17535; O95644; Q04206