Names & Taxonomy
- Uniprot ID:
- P09601
- Entry Name:
- HMOX1_HUMAN
- Status:
- reviewed
- Protein Names:
- Heme oxygenase 1 (HO-1) (EC 1.14.14.18)
- Gene Names:
- HMOX1 HO HO1
- Gene Names Primary:
- HMOX1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 288
- Sequence:
- MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Microsome
Function
- Function:
- Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
- Catalytic Activity:
- Protoheme + 3 + 3 O(2) = biliverdin + Fe(2+) + CO + 3 + 3 H(2)O.
- Cross Reference Drug Bank:
- DB00163
- Gene Ontology Go:
- caveola
cytosol
endoplasmic reticulum
endoplasmic reticulum membrane
extracellular space
membrane
nucleolus
nucleus
perinuclear region of cytoplasm
enzyme binding
heme binding
heme oxygenase (decyclizing) activity
metal ion binding
phospholipase D activity
protein homodimerization activity
signal transducer activity
angiogenesis
cell death
cellular iron ion homeostasis
cellular response to arsenic-containing substance
cellular response to cadmium ion
cellular response to heat
cellular response to hypoxia
cellular response to nutrient
endothelial cell proliferation
erythrocyte homeostasis
excretion
heme catabolic process
heme oxidation
intracellular signal transduction
intrinsic apoptotic signaling pathway in response to DNA damage
iron ion homeostasis
low-density lipoprotein particle clearance
negative regulation of DNA binding
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of leukocyte migration
negative regulation of mast cell cytokine production
negative regulation of mast cell degranulation
negative regulation of muscle cell apoptotic process
negative regulation of neuron apoptotic process
negative regulation of sequence-specific DNA binding transcription factor activity
negative regulation of smooth muscle cell proliferation
porphyrin-containing compound metabolic process
positive regulation of angiogenesis
positive regulation of chemokine biosynthetic process
positive regulation of I-kappaB kinase/NF-kappaB signaling
positive regulation of smooth muscle cell proliferation
positive regulation of vasodilation
protein homooligomerization
regulation of angiogenesis
regulation of blood pressure
regulation of sequence-specific DNA binding transcription factor activity
regulation of transcription from RNA polymerase II promoter in response to iron
regulation of transcription from RNA polymerase II promoter in response to oxidative stress
response to estrogen
response to hydrogen peroxide
response to nicotine
response to oxidative stress
small GTPase mediated signal transduction
small molecule metabolic process
smooth muscle hyperplasia
transmembrane transport
wound healing involved in inflammatory response - Gene Ontology Biological Process:
- angiogenesis
cell death
cellular iron ion homeostasis
cellular response to arsenic-containing substance
cellular response to cadmium ion
cellular response to heat
cellular response to hypoxia
cellular response to nutrient
endothelial cell proliferation
erythrocyte homeostasis
excretion
heme catabolic process
heme oxidation
intracellular signal transduction
intrinsic apoptotic signaling pathway in response to DNA damage
iron ion homeostasis
low-density lipoprotein particle clearance
negative regulation of DNA binding
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of leukocyte migration
negative regulation of mast cell cytokine production
negative regulation of mast cell degranulation
negative regulation of muscle cell apoptotic process
negative regulation of neuron apoptotic process
negative regulation of sequence-specific DNA binding transcription factor activity
negative regulation of smooth muscle cell proliferation
porphyrin-containing compound metabolic process
positive regulation of angiogenesis
positive regulation of chemokine biosynthetic process
positive regulation of I-kappaB kinase/NF-kappaB signaling
positive regulation of smooth muscle cell proliferation
positive regulation of vasodilation
protein homooligomerization
regulation of angiogenesis
regulation of blood pressure
regulation of sequence-specific DNA binding transcription factor activity
regulation of transcription from RNA polymerase II promoter in response to iron
regulation of transcription from RNA polymerase II promoter in response to oxidative stress
response to estrogen
response to hydrogen peroxide
response to nicotine
response to oxidative stress
small GTPase mediated signal transduction
small molecule metabolic process
smooth muscle hyperplasia
transmembrane transport
wound healing involved in inflammatory response - Gene Ontology Molecular Function:
- enzyme binding
heme binding
heme oxygenase (decyclizing) activity
metal ion binding
phospholipase D activity
protein homodimerization activity
signal transducer activity - Gene Ontology Cellular Component:
- caveola
cytosol
endoplasmic reticulum
endoplasmic reticulum membrane
extracellular space
membrane
nucleolus
nucleus
perinuclear region of cytoplasm - Keywords:
- 3D-structure
Apoptosis
Complete proteome
Endoplasmic reticulum
Heme
Iron
Membrane
Metal-binding
Microsome
Oxidoreductase
Phosphoprotein
Polymorphism
Reference proteome - Interacts With:
- Q9NUX5