Names & Taxonomy
- Uniprot ID:
- P08123
- Entry Name:
- CO1A2_HUMAN
- Status:
- reviewed
- Protein Names:
- Collagen alpha-2(I) chain (Alpha-2 type I collagen)
- Gene Names:
- COL1A2
- Gene Names Primary:
- COL1A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 1366
- Sequence:
- MLSFVDTRTLLLLAVTLCLATCQSLQEETVRKGPAGDRGPRGERGPPGPPGRDGEDGPTGPPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGAAGAPGPQGFQGPAGEPGEPGQTGPAGARGPAGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGEIGAVGNAGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNKGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPPGPPGLRGSPGSRGLPGADGRAGVMGPPGSRGASGPAGVRGPNGDAGRPGEPGLMGPRGLPGSPGNIGPAGKEGPVGLPGIDGRPGPIGPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAVGTAGPSGPSGLPGERGAAGIPGGKGEKGEPGLRGEIGNPGRDGARGAPGAVGAPGPAGATGDRGEAGAAGPAGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGERGAKGPKGENGVVGPTGPVGAAGPAGPNGPPGPAGSRGDGGPPGMTGFPGAAGRTGPPGPSGISGPPGPPGPAGKEGLRGPRGDQGPVGRTGEVGAVGPPGFAGEKGPSGEAGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGAVGEPGPLGIAGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGAAGAPGPHGPVGPAGKHGNRGETGPSGPVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space, extracellular matrix
Function
- Function:
- Type I collagen is a member of group I collagen (fibrillar forming collagen).
- Cross Reference Drug Bank:
- DB00048
- Gene Ontology Go:
- collagen type I trimer
endoplasmic reticulum lumen
extracellular exosome
extracellular matrix
extracellular region
extracellular space
extracellular matrix structural constituent
identical protein binding
metal ion binding
platelet-derived growth factor binding
protein binding, bridging
blood coagulation
blood vessel development
cellular response to amino acid stimulus
collagen catabolic process
collagen fibril organization
extracellular matrix disassembly
extracellular matrix organization
leukocyte migration
odontogenesis
platelet activation
protein heterotrimerization
receptor-mediated endocytosis
regulation of blood pressure
regulation of immune response
Rho protein signal transduction
skeletal system development
skin morphogenesis
transforming growth factor beta receptor signaling pathway - Gene Ontology Biological Process:
- blood coagulation
blood vessel development
cellular response to amino acid stimulus
collagen catabolic process
collagen fibril organization
extracellular matrix disassembly
extracellular matrix organization
leukocyte migration
odontogenesis
platelet activation
protein heterotrimerization
receptor-mediated endocytosis
regulation of blood pressure
regulation of immune response
Rho protein signal transduction
skeletal system development
skin morphogenesis
transforming growth factor beta receptor signaling pathway - Gene Ontology Molecular Function:
- extracellular matrix structural constituent
identical protein binding
metal ion binding
platelet-derived growth factor binding
protein binding, bridging - Gene Ontology Cellular Component:
- collagen type I trimer
endoplasmic reticulum lumen
extracellular exosome
extracellular matrix
extracellular region
extracellular space - Keywords:
- Calcium
Chromosomal rearrangement
Collagen
Complete proteome
Direct protein sequencing
Disease mutation
Disulfide bond
Dwarfism
Ehlers-Danlos syndrome
Extracellular matrix
Glycoprotein
Hydroxylation
Metal-binding
Osteogenesis imperfecta
Polymorphism
Pyrrolidone carboxylic acid
Reference proteome
Repeat
Secreted
Signal - Interacts With:
- O43765; Q9UMX0; Q9UMX0-2
Publication
- PubMed ID:
- 2824475 9016532 9443882 15489334 3421913 4011429 2394758 1577745 5529814 3403536 1642148 4412529 2839839 6321602 6687691 1339453 7881420 2364107 6267597 2897363 6309769 6092353 2010058 9101290 1895312 22905912 24275569 3680255 2914942 2777764 2064612 1990009 1874719 2052622 1284475 1385413 8456807 8456808 8444468 8401517 7906591 8094076 7693712 7520724 7959683 8081394 8182080 7891382 7720740 7860070 7749416 8800927 8829649 8723681 10627137 10408781 10987300 15077201 16816023 16879195 16705691 16786509 18272325 18996919 21344539 23656646