Names & Taxonomy
- Uniprot ID:
- P05230
- Entry Name:
- FGF1_HUMAN
- Status:
- reviewed
- Protein Names:
- Fibroblast growth factor 1 (FGF-1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1)
- Gene Names:
- FGF1 FGFA
- Gene Names Primary:
- FGF1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 155
- Sequence:
- MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted. Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytosol. Nucleus. Note=Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1 (By similarity). Binding of exogenous FGF1 to FGFR facilitates endocytosis followed by translocation of FGF1 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as LRRC59.
Function
- Function:
- Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
- Cross Reference Drug Bank:
- DB01025 DB06589 DB00686
- Gene Ontology Go:
- cell cortex
cytosol
extracellular region
extracellular space
nucleolus
nucleoplasm
proteinaceous extracellular matrix
fibroblast growth factor receptor binding
growth factor activity
heparin binding
S100 protein binding
activation of MAPKK activity
anatomical structure morphogenesis
angiogenesis
axon guidance
branch elongation involved in ureteric bud branching
cell proliferation
cellular response to heat
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
lung development
MAPK cascade
mesonephric epithelium development
multicellular organism development
neurotrophin TRK receptor signaling pathway
organ induction
phosphatidylinositol-mediated signaling
positive regulation of angiogenesis
positive regulation of cell division
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of cholesterol biosynthetic process
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of intracellular signal transduction
positive regulation of MAP kinase activity
positive regulation of transcription from RNA polymerase II promoter
Ras protein signal transduction
regulation of endothelial cell chemotaxis to fibroblast growth factor
signal transduction
small GTPase mediated signal transduction
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Biological Process:
- activation of MAPKK activity
anatomical structure morphogenesis
angiogenesis
axon guidance
branch elongation involved in ureteric bud branching
cell proliferation
cellular response to heat
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
lung development
MAPK cascade
mesonephric epithelium development
multicellular organism development
neurotrophin TRK receptor signaling pathway
organ induction
phosphatidylinositol-mediated signaling
positive regulation of angiogenesis
positive regulation of cell division
positive regulation of cell migration
positive regulation of cell proliferation
positive regulation of cholesterol biosynthetic process
positive regulation of epithelial cell proliferation
positive regulation of ERK1 and ERK2 cascade
positive regulation of intracellular signal transduction
positive regulation of MAP kinase activity
positive regulation of transcription from RNA polymerase II promoter
Ras protein signal transduction
regulation of endothelial cell chemotaxis to fibroblast growth factor
signal transduction
small GTPase mediated signal transduction
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Molecular Function:
- fibroblast growth factor receptor binding
growth factor activity
heparin binding
S100 protein binding - Gene Ontology Cellular Component:
- cell cortex
cytosol
extracellular region
extracellular space
nucleolus
nucleoplasm
proteinaceous extracellular matrix - Keywords:
- 3D-structure
Acetylation
Alternative splicing
Angiogenesis
Complete proteome
Cytoplasm
Developmental protein
Differentiation
Direct protein sequencing
Growth factor
Heparin-binding
Mitogen
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Secreted - Interacts With:
- P11362; P21802; P22607
Publication
- PubMed ID:
- 3523756 2590193 2474753 1693186 1717925 1372643 7504343 14702039 15372022 15489334 2393407 2427112 3527167 3778488 3964259 3732516 1885605 8663044 11432880 11964394 16597617 18400376 20863990 15863030 20094046 22321063 1702556 8652550 9655399 10830168 11069186 10618369 11847269 14732692 7521397 8950275 9719643 20145243 20220137