Names & Taxonomy
- Uniprot ID:
- Q86SZ2
- Entry Name:
- TPC6B_HUMAN
- Status:
- reviewed
- Protein Names:
- Trafficking protein particle complex subunit 6B
- Gene Names:
- TRAPPC6B
- Gene Names Primary:
- TRAPPC6B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 158
- Sequence:
- MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Golgi apparatus, cis-Golgi network
Function
- Function:
- May play a role in vesicular transport from endoplasmic reticulum to Golgi.
- Gene Ontology Go:
- cytosol
endoplasmic reticulum
Golgi membrane
cellular protein metabolic process
COPII vesicle coating
ER to Golgi vesicle-mediated transport
membrane organization
post-translational protein modification
protein N-linked glycosylation via asparagine - Gene Ontology Biological Process:
- cellular protein metabolic process
COPII vesicle coating
ER to Golgi vesicle-mediated transport
membrane organization
post-translational protein modification
protein N-linked glycosylation via asparagine - Gene Ontology Cellular Component:
- cytosol
endoplasmic reticulum
Golgi membrane - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
ER-Golgi transport
Endoplasmic reticulum
Golgi apparatus
Reference proteome
Transport - Interacts With:
- O43617