Names & Taxonomy
- Uniprot ID:
- Q16873
- Entry Name:
- LTC4S_HUMAN
- Status:
- reviewed
- Protein Names:
- Leukotriene C4 synthase (LTC4 synthase) (EC 4.4.1.20) (Leukotriene-C(4) synthase)
- Gene Names:
- LTC4S
- Gene Names Primary:
- LTC4S
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 150
- Sequence:
- MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Function
- Function:
- Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4.
- Catalytic Activity:
- Leukotriene C(4) = leukotriene A(4) + glutathione.
- Active Site:
- ACT_SITE 31 31 Proton donor.
- Cross Reference Drug Bank:
- DB00143
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum membrane
integral component of membrane
intracellular membrane-bounded organelle
nuclear envelope
nuclear outer membrane
enzyme activator activity
glutathione binding
glutathione peroxidase activity
glutathione transferase activity
leukotriene-C4 synthase activity
lipid binding
arachidonic acid metabolic process
cellular oxidant detoxification
cellular response to lipopolysaccharide
cellular response to vitamin A
leukotriene biosynthetic process
leukotriene metabolic process
lipoxin metabolic process
lipoxygenase pathway
response to axon injury
response to drug
response to inorganic substance
small molecule metabolic process - Gene Ontology Biological Process:
- arachidonic acid metabolic process
cellular oxidant detoxification
cellular response to lipopolysaccharide
cellular response to vitamin A
leukotriene biosynthetic process
leukotriene metabolic process
lipoxin metabolic process
lipoxygenase pathway
response to axon injury
response to drug
response to inorganic substance
small molecule metabolic process - Gene Ontology Molecular Function:
- enzyme activator activity
glutathione binding
glutathione peroxidase activity
glutathione transferase activity
leukotriene-C4 synthase activity
lipid binding - Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum membrane
integral component of membrane
intracellular membrane-bounded organelle
nuclear envelope
nuclear outer membrane - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Endoplasmic reticulum
Leukotriene biosynthesis
Lyase
Membrane
Nucleus
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix