Names & Taxonomy
- Uniprot ID:
- Q16558
- Entry Name:
- KCMB1_HUMAN
- Status:
- reviewed
- Protein Names:
- Calcium-activated potassium channel subunit beta-1 (BK channel subunit beta-1) (BKbeta) (BKbeta1) (Hbeta1) (Calcium-activated potassium channel, subfamily M subunit beta-1) (Calcium-activated potassium channel subunit beta) (Charybdotoxin receptor subunit beta-1) (K(VCA)beta-1) (Maxi K channel subunit beta-1) (Slo-beta-1) (Slo-beta)
- Gene Names:
- KCNMB1
- Gene Names Primary:
- KCNMB1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 191
- Sequence:
- MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Multi-pass membrane protein.
Function
- Function:
- Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.
- Cross Reference Drug Bank:
- DB01110 DB00721
- Gene Ontology Go:
- plasma membrane
voltage-gated potassium channel complex
calcium-activated potassium channel activity
potassium channel regulator activity
blood coagulation
detection of calcium ion
potassium ion transmembrane transport
potassium ion transport
synaptic transmission - Gene Ontology Biological Process:
- blood coagulation
detection of calcium ion
potassium ion transmembrane transport
potassium ion transport
synaptic transmission - Gene Ontology Molecular Function:
- calcium-activated potassium channel activity
potassium channel regulator activity - Gene Ontology Cellular Component:
- plasma membrane
voltage-gated potassium channel complex - Keywords:
- Alternative splicing
Complete proteome
Glycoprotein
Ion channel
Ion transport
Membrane
Polymorphism
Reference proteome
Transmembrane
Transmembrane helix
Transport