Names & Taxonomy
- Uniprot ID:
- Q16552
- Entry Name:
- IL17_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
- Gene Names:
- IL17A CTLA8 IL17
- Gene Names Primary:
- IL17A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 155
- Sequence:
- MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines (PubMed:8676080).
- Cross Reference Drug Bank:
- DB09029
- Gene Ontology Go:
- cytoplasm
external side of plasma membrane
extracellular space
cytokine activity
cytokine receptor binding
apoptotic process
cell death
cell surface receptor signaling pathway
cell-cell signaling
cellular response to glucocorticoid stimulus
cellular response to interleukin-1
defense response to fungus
fibroblast activation
immune response
inflammatory response
positive regulation of cytokine production involved in inflammatory response
positive regulation of interleukin-23 production
positive regulation of interleukin-6 secretion
positive regulation of necrotic cell death
positive regulation of osteoclast differentiation
positive regulation of transcription from RNA polymerase II promoter
response to amino acid - Gene Ontology Biological Process:
- apoptotic process
cell-cell signaling
cell death
cell surface receptor signaling pathway
cellular response to glucocorticoid stimulus
cellular response to interleukin-1
defense response to fungus
fibroblast activation
immune response
inflammatory response
positive regulation of cytokine production involved in inflammatory response
positive regulation of interleukin-23 production
positive regulation of interleukin-6 secretion
positive regulation of necrotic cell death
positive regulation of osteoclast differentiation
positive regulation of transcription from RNA polymerase II promoter
response to amino acid - Gene Ontology Molecular Function:
- cytokine activity
cytokine receptor binding - Gene Ontology Cellular Component:
- cytoplasm
external side of plasma membrane
extracellular space - Keywords:
- 3D-structure
Complete proteome
Cytokine
Direct protein sequencing
Disulfide bond
Glycoprotein
Reference proteome
Secreted
Signal - Interacts With:
- Q9BQC3