Names & Taxonomy
- Uniprot ID:
- Q13956
- Entry Name:
- CNCG_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (GMP-PDE gamma) (EC 3.1.4.35)
- Gene Names:
- PDE6H
- Gene Names Primary:
- PDE6H
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 83
- Sequence:
- MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII
- Proteomes:
- UP000005640
Function
- Function:
- Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
- Catalytic Activity:
- Guanosine 3',5'-cyclic phosphate + H(2)O = guanosine 5'-phosphate.
- Cross Reference Drug Bank:
- DB00203 DB00862
- Gene Ontology Go:
- 3',5'-cyclic-GMP phosphodiesterase activity
cGMP binding
enzyme inhibitor activity
activation of MAPK activity
negative regulation of catalytic activity
positive regulation of epidermal growth factor receptor signaling pathway
positive regulation of G-protein coupled receptor protein signaling pathway
response to stimulus
visual perception - Gene Ontology Biological Process:
- activation of MAPK activity
negative regulation of catalytic activity
positive regulation of epidermal growth factor receptor signaling pathway
positive regulation of G-protein coupled receptor protein signaling pathway
response to stimulus
visual perception - Gene Ontology Molecular Function:
- 3',5'-cyclic-GMP phosphodiesterase activity
cGMP binding
enzyme inhibitor activity - Keywords:
- Complete proteome
Hydrolase
Reference proteome
Sensory transduction
Vision
cGMP - Interacts With:
- Q6NUP5; Q14019