Drug Miner Browse

Names & Taxonomy

Uniprot ID:: Q13838
Entry Name:: DX39B_HUMAN
Status:: reviewed
Protein Names:: Spliceosome RNA helicase DDX39B (EC 3.6.4.13) (56 kDa U2AF65-associated protein) (ATP-dependent RNA helicase p47) (DEAD box protein UAP56) (HLA-B-associated transcript 1 protein)
Gene Names:: DDX39B BAT1 UAP56
Gene Names Primary:: DDX39B
Organism:: Homo sapiens (Human)

Structure

Length:: 428
Sequence:: MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Proteomes:: UP000005640

Subcellular location

Subcellular Location:: Nucleus. Nucleus speckle. Cytoplasm. Note=Can translocate to the cytoplasm in the presence of MX1. TREX complex assembly seems to occur in regions surrounding nuclear speckles known as perispeckles.

Function

Function:: Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. Also associates with pre-mRNA independent of ALYREF/THOC4 and the THO complex. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability.; Splice factor that is required for the first ATP-dependent step in spliceosome assembly and for the interaction of U2 snRNP with the branchpoint. Has both RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity. Even with the stimulation of RNA, the ATPase activity is weak. Can only hydrolyze ATP but not other NTPs. The RNA stimulation of ATPase activity does not have a strong preference for the sequence and length of the RNA. However, ssRNA stimulates the ATPase activity much more strongly than dsRNA. Can unwind 5' or 3' overhangs or blunt end RNA duplexes in vitro. The ATPase and helicase activities are not influenced by U2AF2; the effect of ALYREF/THOC4 is reported conflictingly with reporting a stimulatory effect.
Catalytic Activity:: ATP + H(2)O = ADP + phosphate.
Kinetics:: BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=3.3 uM for ATP
Cross Reference Drug Bank:: DB02325
Gene Ontology Go:: cytoplasm
nuclear matrix
nuclear speck
nucleoplasm
nucleus
spliceosomal complex
transcription export complex
ATP binding
ATP-dependent protein binding
ATP-dependent RNA helicase activity
poly(A) RNA binding
RNA-dependent ATPase activity
U4 snRNA binding
U6 snRNA binding
cellular response to DNA damage stimulus
liver development
mRNA export from nucleus
mRNA splicing, via spliceosome
negative regulation of DNA damage checkpoint
positive regulation of cell growth involved in cardiac muscle cell development
positive regulation of DNA biosynthetic process
positive regulation of DNA-templated transcription, elongation
positive regulation of translation
positive regulation of vascular smooth muscle cell proliferation
RNA secondary structure unwinding
RNA splicing
spliceosomal complex assembly
viral mRNA export from host cell nucleus
Gene Ontology Biological Process:: cellular response to DNA damage stimulus
liver development
mRNA export from nucleus
mRNA splicing, via spliceosome
negative regulation of DNA damage checkpoint
positive regulation of cell growth involved in cardiac muscle cell development
positive regulation of DNA biosynthetic process
positive regulation of DNA-templated transcription, elongation
positive regulation of translation
positive regulation of vascular smooth muscle cell proliferation
RNA secondary structure unwinding
RNA splicing
spliceosomal complex assembly
viral mRNA export from host cell nucleus
Gene Ontology Molecular Function:: ATP binding
ATP-dependent protein binding
ATP-dependent RNA helicase activity
poly(A) RNA binding
RNA-dependent ATPase activity
U4 snRNA binding
U6 snRNA binding
Gene Ontology Cellular Component:: cytoplasm
nuclear matrix
nuclear speck
nucleoplasm
nucleus
spliceosomal complex
transcription export complex
Keywords:: 3D-structure
ATP-binding
Acetylation
Alternative splicing
Complete proteome
Cytoplasm
Helicase
Hydrolase
Isopeptide bond
Nucleotide-binding
Nucleus
Phosphoprotein
RNA-binding
Reference proteome
Spliceosome
Transport
Ubl conjugation
mRNA processing
mRNA splicing
mRNA transport
Interacts With:: Q86V81; Q9Y3Y2

Names & Taxonomy

Structure

Subcellular location

Function

Publication