Names & Taxonomy
- Uniprot ID:
- Q0GM93
- Entry Name:
- Q0GM93_HUMAN
- Status:
- unreviewed
- Protein Names:
- Purinergic receptor P2X ligand-gated ion channel 4 (Fragment)
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 123
- Sequence:
- AAWCPVEXDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDV
Function
- Gene Ontology Go:
- integral component of plasma membrane
ATP binding
extracellular ATP-gated cation channel activity
purinergic nucleotide receptor activity
response to ATP - Gene Ontology Biological Process:
- response to ATP
- Gene Ontology Molecular Function:
- ATP binding
extracellular ATP-gated cation channel activity
purinergic nucleotide receptor activity - Gene Ontology Cellular Component:
- integral component of plasma membrane
- Keywords:
- Receptor