Names & Taxonomy
- Uniprot ID:
- Q05940
- Entry Name:
- VMAT2_HUMAN
- Status:
- reviewed
- Protein Names:
- Synaptic vesicular amine transporter (Monoamine transporter) (Solute carrier family 18 member 2) (Vesicular amine transporter 2) (VAT2)
- Gene Names:
- SLC18A2 SVMT VMAT2
- Gene Names Primary:
- SLC18A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 514
- Sequence:
- MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Function
- Function:
- Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
- Cross Reference Drug Bank:
- DB00182 DB00865 DB01089 DB01576 DB01363 DB01364 DB06706 DB01577 DB00368 DB06714 DB00206 DB04844
- Gene Ontology Go:
- clathrin-sculpted monoamine transport vesicle membrane
dense core granule
integral component of plasma membrane
membrane
neuronal cell body
plasma membrane
synaptic vesicle
synaptic vesicle membrane
terminal bouton
amine transmembrane transporter activity
drug binding
monoamine transmembrane transporter activity
serotonin transmembrane transporter activity
aging
aminergic neurotransmitter loading into synaptic vesicle
cellular response to ammonium ion
cellular response to drug
dopamine transport
endocytic recycling
glucose homeostasis
insulin secretion
locomotory behavior
monoamine transport
negative regulation of neurotransmitter transport
negative regulation of reactive oxygen species biosynthetic process
neurotransmitter loading into synaptic vesicle
neurotransmitter secretion
post-embryonic development
response to amphetamine
response to cocaine
response to corticosterone
response to herbicide
response to starvation
response to zinc ion
sequestering of neurotransmitter
synaptic transmission
transmembrane transport - Gene Ontology Biological Process:
- aging
aminergic neurotransmitter loading into synaptic vesicle
cellular response to ammonium ion
cellular response to drug
dopamine transport
endocytic recycling
glucose homeostasis
insulin secretion
locomotory behavior
monoamine transport
negative regulation of neurotransmitter transport
negative regulation of reactive oxygen species biosynthetic process
neurotransmitter loading into synaptic vesicle
neurotransmitter secretion
post-embryonic development
response to amphetamine
response to cocaine
response to corticosterone
response to herbicide
response to starvation
response to zinc ion
sequestering of neurotransmitter
synaptic transmission
transmembrane transport - Gene Ontology Molecular Function:
- amine transmembrane transporter activity
drug binding
monoamine transmembrane transporter activity
serotonin transmembrane transporter activity - Gene Ontology Cellular Component:
- clathrin-sculpted monoamine transport vesicle membrane
dense core granule
integral component of plasma membrane
membrane
neuronal cell body
plasma membrane
synaptic vesicle
synaptic vesicle membrane
terminal bouton - Keywords:
- Alternative splicing
Complete proteome
Cytoplasmic vesicle
Disulfide bond
Glycoprotein
Membrane
Neurotransmitter transport
Phosphoprotein
Reference proteome
Transmembrane
Transmembrane helix
Transport