Names & Taxonomy
- Uniprot ID:
- Q01955
- Entry Name:
- CO4A3_HUMAN
- Status:
- reviewed
- Protein Names:
- Collagen alpha-3(IV) chain (Goodpasture antigen) [Cleaved into: Tumstatin]
- Gene Names:
- COL4A3
- Gene Names Primary:
- COL4A3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 1670
- Sequence:
- MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSPGQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLVGVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPGPQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPGKDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCPYIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEKGETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGDPGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGPPGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSLGCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPGTPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAIGPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLKGFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNMGMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMGKKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPGLPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFPGLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPGSHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGEKGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGPPGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space, extracellular matrix, basement membrane. Note=Colocalizes with COL4A4 and COL4A5 in GBM, tubular basement membrane (TBM) and synaptic basal lamina (BL).
Function
- Function:
- Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.; Tumstatin, a cleavage fragment corresponding to the collagen alpha 3(IV) NC1 domain, possesses both anti-angiogenic and anti-tumor cell activity; these two anti-tumor properties may be regulated via RGD-independent ITGB3-mediated mechanisms.
- Gene Ontology Go:
- basement membrane
collagen type IV trimer
endoplasmic reticulum
endoplasmic reticulum lumen
extracellular region
intracellular membrane-bounded organelle
extracellular matrix structural constituent
integrin binding
metalloendopeptidase inhibitor activity
structural molecule activity
activation of cysteine-type endopeptidase activity involved in apoptotic process
axon guidance
blood circulation
cell adhesion
cell proliferation
cell surface receptor signaling pathway
collagen catabolic process
endothelial cell apoptotic process
extracellular matrix disassembly
extracellular matrix organization
glomerular basement membrane development
negative regulation of angiogenesis
negative regulation of cell proliferation
negative regulation of endopeptidase activity
sensory perception of sound - Gene Ontology Biological Process:
- activation of cysteine-type endopeptidase activity involved in apoptotic process
axon guidance
blood circulation
cell adhesion
cell proliferation
cell surface receptor signaling pathway
collagen catabolic process
endothelial cell apoptotic process
extracellular matrix disassembly
extracellular matrix organization
glomerular basement membrane development
negative regulation of angiogenesis
negative regulation of cell proliferation
negative regulation of endopeptidase activity
sensory perception of sound - Gene Ontology Molecular Function:
- extracellular matrix structural constituent
integrin binding
metalloendopeptidase inhibitor activity
structural molecule activity - Gene Ontology Cellular Component:
- basement membrane
collagen type IV trimer
endoplasmic reticulum
endoplasmic reticulum lumen
extracellular region
intracellular membrane-bounded organelle - Keywords:
- Alport syndrome
Alternative splicing
Basement membrane
Cell adhesion
Collagen
Complete proteome
Deafness
Direct protein sequencing
Disease mutation
Disulfide bond
Extracellular matrix
Glycoprotein
Hydroxylation
Isopeptide bond
Phosphoprotein
Polymorphism
Reference proteome
Repeat
Secreted
Signal
Ubl conjugation