Names & Taxonomy
- Uniprot ID:
- Q01860
- Entry Name:
- PO5F1_HUMAN
- Status:
- reviewed
- Protein Names:
- POU domain, class 5, transcription factor 1 (Octamer-binding protein 3) (Oct-3) (Octamer-binding protein 4) (Oct-4) (Octamer-binding transcription factor 3) (OTF-3)
- Gene Names:
- POU5F1 OCT3 OCT4 OTF3
- Gene Names Primary:
- POU5F1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 360
- Sequence:
- MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm. Nucleus. Note=Expressed in a diffuse and slightly punctuate pattern.
Function
- Function:
- Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
- Cross Reference Drug Bank:
- DB00988 DB00368
- Gene Ontology Go:
- cytoplasm
cytosol
nucleoplasm
nucleus
transcription factor complex
DNA binding
miRNA binding
poly(A) RNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
sequence-specific DNA binding
transcription factor activity, sequence-specific DNA binding
transcription factor binding
transcription regulatory region DNA binding
transcription regulatory region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
ubiquitin protein ligase binding
anatomical structure morphogenesis
blastocyst development
BMP signaling pathway involved in heart induction
cardiac cell fate determination
cell fate commitment involved in formation of primary germ layer
endodermal cell fate specification
mRNA transcription from RNA polymerase II promoter
negative regulation of gene silencing by miRNA
negative regulation of transcription from RNA polymerase II promoter
positive regulation of catenin import into nucleus
positive regulation of SMAD protein import into nucleus
positive regulation of transcription from RNA polymerase II promoter
regulation of asymmetric cell division
regulation of gene expression
regulation of heart induction by regulation of canonical Wnt signaling pathway
regulation of methylation-dependent chromatin silencing
regulation of transcription, DNA-templated
response to wounding
somatic stem cell population maintenance
transcription from RNA polymerase II promoter - Gene Ontology Biological Process:
- anatomical structure morphogenesis
blastocyst development
BMP signaling pathway involved in heart induction
cardiac cell fate determination
cell fate commitment involved in formation of primary germ layer
endodermal cell fate specification
mRNA transcription from RNA polymerase II promoter
negative regulation of gene silencing by miRNA
negative regulation of transcription from RNA polymerase II promoter
positive regulation of catenin import into nucleus
positive regulation of SMAD protein import into nucleus
positive regulation of transcription from RNA polymerase II promoter
regulation of asymmetric cell division
regulation of gene expression
regulation of heart induction by regulation of canonical Wnt signaling pathway
regulation of methylation-dependent chromatin silencing
regulation of transcription, DNA-templated
response to wounding
somatic stem cell population maintenance
transcription from RNA polymerase II promoter - Gene Ontology Molecular Function:
- DNA binding
miRNA binding
poly(A) RNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
transcription factor binding
transcription regulatory region DNA binding
transcription regulatory region sequence-specific DNA binding
ubiquitin protein ligase binding - Gene Ontology Cellular Component:
- cytoplasm
cytosol
nucleoplasm
nucleus
transcription factor complex - Keywords:
- Alternative splicing
Complete proteome
Cytoplasm
DNA-binding
Developmental protein
Homeobox
Isopeptide bond
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Transcription
Transcription regulation
Ubl conjugation - Interacts With:
- P03259; Q8JSK4; Q9UJU5; P63158; O00308