Names & Taxonomy
- Uniprot ID:
- P63027
- Entry Name:
- VAMP2_HUMAN
- Status:
- reviewed
- Protein Names:
- Vesicle-associated membrane protein 2 (VAMP-2) (Synaptobrevin-2)
- Gene Names:
- VAMP2 SYB2
- Gene Names Primary:
- VAMP2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 116
- Sequence:
- MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane
Function
- Function:
- Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
- Cross Reference Drug Bank:
- DB00042
- Gene Ontology Go:
- cell junction
clathrin-coated vesicle
clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane
clathrin-sculpted glutamate transport vesicle membrane
clathrin-sculpted monoamine transport vesicle membrane
cytoplasmic vesicle
cytosol
extracellular exosome
integral component of plasma membrane
intracellular membrane-bounded organelle
membrane
neuron projection
neuron projection terminus
perinuclear region of cytoplasm
plasma membrane
secretory granule
secretory granule membrane
SNARE complex
storage vacuole
synapse
synaptic vesicle
synaptic vesicle membrane
synaptobrevin 2-SNAP-25-syntaxin-1a complex
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
terminal bouton
trans-Golgi network
vesicle
voltage-gated potassium channel complex
zymogen granule membrane
calcium-dependent protein binding
calmodulin binding
phospholipid binding
protein self-association
SNAP receptor activity
SNARE binding
syntaxin binding
syntaxin-1 binding
calcium ion regulated exocytosis
cellular protein metabolic process
cellular response to insulin stimulus
energy reserve metabolic process
eosinophil degranulation
exocytosis
glutamate secretion
Golgi to plasma membrane protein transport
long-term synaptic potentiation
membrane fusion
membrane organization
neurotransmitter secretion
positive regulation of intracellular protein transport
post-Golgi vesicle-mediated transport
protein complex assembly
protein transport
regulation of delayed rectifier potassium channel activity
regulation of exocytosis
regulation of insulin secretion
regulation of vesicle-mediated transport
response to glucose
small molecule metabolic process
synaptic transmission
synaptic vesicle exocytosis
vesicle fusion
vesicle-mediated transport - Gene Ontology Biological Process:
- calcium ion regulated exocytosis
cellular protein metabolic process
cellular response to insulin stimulus
energy reserve metabolic process
eosinophil degranulation
exocytosis
glutamate secretion
Golgi to plasma membrane protein transport
long-term synaptic potentiation
membrane fusion
membrane organization
neurotransmitter secretion
positive regulation of intracellular protein transport
post-Golgi vesicle-mediated transport
protein complex assembly
protein transport
regulation of delayed rectifier potassium channel activity
regulation of exocytosis
regulation of insulin secretion
regulation of vesicle-mediated transport
response to glucose
small molecule metabolic process
synaptic transmission
synaptic vesicle exocytosis
vesicle fusion
vesicle-mediated transport - Gene Ontology Molecular Function:
- calcium-dependent protein binding
calmodulin binding
phospholipid binding
protein self-association
SNAP receptor activity
SNARE binding
syntaxin-1 binding
syntaxin binding - Gene Ontology Cellular Component:
- cell junction
clathrin-coated vesicle
clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane
clathrin-sculpted glutamate transport vesicle membrane
clathrin-sculpted monoamine transport vesicle membrane
cytoplasmic vesicle
cytosol
extracellular exosome
integral component of plasma membrane
intracellular membrane-bounded organelle
membrane
neuron projection
neuron projection terminus
perinuclear region of cytoplasm
plasma membrane
secretory granule
secretory granule membrane
SNARE complex
storage vacuole
synapse
synaptic vesicle
synaptic vesicle membrane
synaptobrevin 2-SNAP-25-syntaxin-1a complex
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
terminal bouton
trans-Golgi network
vesicle
voltage-gated potassium channel complex
zymogen granule membrane - Keywords:
- 3D-structure
Acetylation
Cell junction
Cell membrane
Coiled coil
Complete proteome
Cytoplasmic vesicle
Membrane
Phosphoprotein
Reference proteome
Synapse
Synaptosome
Transmembrane
Transmembrane helix - Interacts With:
- D2KHQ9; A7GBG3; O55012; O94806; O95721; Q12846