Names & Taxonomy
- Uniprot ID:
- P62312
- Entry Name:
- LSM6_HUMAN
- Status:
- reviewed
- Protein Names:
- U6 snRNA-associated Sm-like protein LSm6
- Gene Names:
- LSM6
- Gene Names Primary:
- LSM6
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 80
- Sequence:
- MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 di-snRNP, spliceosomal U4/U6.U5 tri-snRNP, and free U6 snRNP). It binds directly to the 3'-terminal U-tract of U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. LSM2-LSM8 probably also is involved degradation of nuclear pre-mRNA by targeting them for decapping, and in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA (By similarity).
- Gene Ontology Go:
- cytoplasmic mRNA processing body
cytosol
extracellular exosome
nucleolus
nucleoplasm
small nuclear ribonucleoprotein complex
small nucleolar ribonucleoprotein complex
spliceosomal complex
U4/U6 x U5 tri-snRNP complex
U6 snRNP
poly(A) RNA binding
RNA binding
exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
gene expression
maturation of SSU-rRNA
mRNA splicing, via spliceosome
nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
RNA splicing
tRNA processing - Gene Ontology Biological Process:
- exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
gene expression
maturation of SSU-rRNA
mRNA splicing, via spliceosome
nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
RNA splicing
tRNA processing - Gene Ontology Molecular Function:
- poly(A) RNA binding
RNA binding - Gene Ontology Cellular Component:
- cytoplasmic mRNA processing body
cytosol
extracellular exosome
nucleolus
nucleoplasm
small nuclear ribonucleoprotein complex
small nucleolar ribonucleoprotein complex
spliceosomal complex
U4/U6 x U5 tri-snRNP complex
U6 snRNP - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Nucleus
RNA-binding
Reference proteome
Ribonucleoprotein
Spliceosome
mRNA processing
mRNA splicing
rRNA processing
tRNA processing - Interacts With:
- P54105; P62310; Q9Y4Y9; Q9UK45; O00560