Names & Taxonomy
- Uniprot ID:
- P61925
- Entry Name:
- IPKA_HUMAN
- Status:
- reviewed
- Protein Names:
- cAMP-dependent protein kinase inhibitor alpha (PKI-alpha) (cAMP-dependent protein kinase inhibitor, muscle/brain isoform)
- Gene Names:
- PKIA PRKACN1
- Gene Names Primary:
- PKIA
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 76
- Sequence:
- MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES
- Proteomes:
- UP000005640
Function
- Function:
- Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
- Gene Ontology Go:
- cytoplasm
nucleus
cAMP-dependent protein kinase inhibitor activity
protein kinase A catalytic subunit binding
negative regulation of cAMP-dependent protein kinase activity
negative regulation of protein import into nucleus
negative regulation of transcription from RNA polymerase II promoter
regulation of G2/M transition of mitotic cell cycle - Gene Ontology Biological Process:
- negative regulation of cAMP-dependent protein kinase activity
negative regulation of protein import into nucleus
negative regulation of transcription from RNA polymerase II promoter
regulation of G2/M transition of mitotic cell cycle - Gene Ontology Molecular Function:
- cAMP-dependent protein kinase inhibitor activity
protein kinase A catalytic subunit binding - Gene Ontology Cellular Component:
- cytoplasm
nucleus - Keywords:
- 3D-structure
Acetylation
Complete proteome
Protein kinase inhibitor
Reference proteome - Interacts With:
- P30822; O14980