Drug Miner Browse

Names & Taxonomy

Uniprot ID:: P61586
Entry Name:: RHOA_HUMAN
Status:: reviewed
Protein Names:: Transforming protein RhoA (Rho cDNA clone 12) (h12)
Gene Names:: RHOA ARH12 ARHA RHO12
Gene Names Primary:: RHOA
Organism:: Homo sapiens (Human)

Structure

Length:: 193
Sequence:: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Proteomes:: UP000005640

Subcellular location

Subcellular Location:: Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton. Cleavage furrow. Cytoplasm, cell cortex

Function

Function:: Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization (By similarity). Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis (PubMed:9635436, PubMed:19403695).
Cofactor:: COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
Enzyme Regulation:: ENZYME REGULATION: GTP hydrolysis is stimulated by ARHGAP30.
Gene Ontology Go:: apical junction complex
cell cortex
cell junction
cell periphery
cleavage furrow
cytoskeleton
cytosol
endoplasmic reticulum membrane
endosome
extracellular exosome
extrinsic component of cytoplasmic side of plasma membrane
focal adhesion
lamellipodium
midbody
plasma membrane
vesicle
GTP binding
GTPase activity
myosin binding
actin cytoskeleton organization
actin cytoskeleton reorganization
apical junction assembly
apolipoprotein A-I-mediated signaling pathway
axon guidance
blood coagulation
cell migration
cleavage furrow formation
endothelial cell migration
endothelial tube lumen extension
ephrin receptor signaling pathway
mitotic cleavage furrow formation
mitotic spindle assembly
negative chemotaxis
negative regulation of axonogenesis
negative regulation of cell migration involved in sprouting angiogenesis
neurotrophin TRK receptor signaling pathway
ossification involved in bone maturation
phosphatidylinositol-mediated signaling
platelet activation
positive regulation of axonogenesis
positive regulation of cytokinesis
positive regulation of I-kappaB kinase/NF-kappaB signaling
positive regulation of lipase activity
positive regulation of neuron differentiation
positive regulation of NF-kappaB import into nucleus
positive regulation of protein serine/threonine kinase activity
positive regulation of stress fiber assembly
regulation of actin cytoskeleton organization
regulation of axonogenesis
regulation of cell migration
regulation of osteoblast proliferation
regulation of small GTPase mediated signal transduction
Rho protein signal transduction
Roundabout signaling pathway
skeletal muscle satellite cell migration
small GTPase mediated signal transduction
stress fiber assembly
substantia nigra development
trabecula morphogenesis
transforming growth factor beta receptor signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process
Wnt signaling pathway, planar cell polarity pathway
wound healing, spreading of cells
Gene Ontology Biological Process:: actin cytoskeleton organization
actin cytoskeleton reorganization
apical junction assembly
apolipoprotein A-I-mediated signaling pathway
axon guidance
blood coagulation
cell migration
cleavage furrow formation
endothelial cell migration
endothelial tube lumen extension
ephrin receptor signaling pathway
mitotic cleavage furrow formation
mitotic spindle assembly
negative chemotaxis
negative regulation of axonogenesis
negative regulation of cell migration involved in sprouting angiogenesis
neurotrophin TRK receptor signaling pathway
ossification involved in bone maturation
phosphatidylinositol-mediated signaling
platelet activation
positive regulation of axonogenesis
positive regulation of cytokinesis
positive regulation of I-kappaB kinase/NF-kappaB signaling
positive regulation of lipase activity
positive regulation of neuron differentiation
positive regulation of NF-kappaB import into nucleus
positive regulation of protein serine/threonine kinase activity
positive regulation of stress fiber assembly
regulation of actin cytoskeleton organization
regulation of axonogenesis
regulation of cell migration
regulation of osteoblast proliferation
regulation of small GTPase mediated signal transduction
Rho protein signal transduction
Roundabout signaling pathway
skeletal muscle satellite cell migration
small GTPase mediated signal transduction
stress fiber assembly
substantia nigra development
trabecula morphogenesis
transforming growth factor beta receptor signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process
Wnt signaling pathway, planar cell polarity pathway
wound healing, spreading of cells
Gene Ontology Molecular Function:: GTPase activity
GTP binding
myosin binding
Gene Ontology Cellular Component:: apical junction complex
cell cortex
cell junction
cell periphery
cleavage furrow
cytoskeleton
cytosol
endoplasmic reticulum membrane
endosome
extracellular exosome
extrinsic component of cytoplasmic side of plasma membrane
focal adhesion
lamellipodium
midbody
plasma membrane
vesicle
Keywords:: 3D-structure
ADP-ribosylation
Cell cycle
Cell division
Cell membrane
Cell projection
Complete proteome
Cytoplasm
Cytoskeleton
Direct protein sequencing
GTP-binding
Glycoprotein
Host-virus interaction
Lipoprotein
Magnesium
Membrane
Methylation
Nucleotide-binding
Phosphoprotein
Prenylation
Proto-oncogene
Reference proteome
Ubl conjugation
Interacts With:: Q15109; Q07960; P52565; O15085; Q9NZN5; Q8IW93; Q9Y4D1; O60610; O08808; Q9Y4F9; Q9UKT9; Q6PDM6; P19338; Q9Z0S9; Q13464; Q9BST9; Q8C6B2; Q15796; Q9HCE7-2; A0A0F6B1Q8; Q15654

Names & Taxonomy

Structure

Subcellular location

Function

Publication