Names & Taxonomy
- Uniprot ID:
- P35462
- Entry Name:
- DRD3_HUMAN
- Status:
- reviewed
- Protein Names:
- D(3) dopamine receptor (Dopamine D3 receptor)
- Gene Names:
- DRD3
- Gene Names Primary:
- DRD3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 400
- Sequence:
- MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
- Cross Reference Drug Bank:
- DB06288 DB00543 DB00714 DB01238 DB06216 DB01200 DB00248 DB09014 DB06016 DB00477 DB01239 DB00363 DB01184 DB00988 DB00502 DB04946 DB01235 DB00589 DB00408 DB01403 DB06148 DB00370 DB00334 DB01267 DB01186 DB01100 DB00413 DB01224 DB00409 DB00734 DB00268 DB05271 DB00391 DB01392 DB00246
- Gene Ontology Go:
- apical part of cell
cell projection
endocytic vesicle
integral component of plasma membrane
plasma membrane
dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
dopamine neurotransmitter receptor activity, coupled via Gs
drug binding
acid secretion
adenylate cyclase-activating dopamine receptor signaling pathway
adenylate cyclase-inhibiting dopamine receptor signaling pathway
arachidonic acid secretion
behavioral response to cocaine
cellular calcium ion homeostasis
circadian regulation of gene expression
dopamine metabolic process
G-protein coupled receptor internalization
G-protein coupled receptor signaling pathway
gastric emptying
learning
learning or memory
locomotory behavior
musculoskeletal movement, spinal reflex action
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of dopamine receptor signaling pathway
negative regulation of oligodendrocyte differentiation
negative regulation of protein kinase B signaling
negative regulation of protein secretion
negative regulation of sodium:proton antiporter activity
negative regulation of transcription from RNA polymerase II promoter
positive regulation of cell proliferation
positive regulation of cytokinesis
positive regulation of dopamine receptor signaling pathway
positive regulation of mitotic nuclear division
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
prepulse inhibition
regulation of blood volume by renin-angiotensin
regulation of cAMP metabolic process
regulation of circadian sleep/wake cycle, sleep
regulation of dopamine secretion
regulation of dopamine uptake involved in synaptic transmission
regulation of lipid metabolic process
regulation of locomotion involved in locomotory behavior
regulation of multicellular organism growth
response to amphetamine
response to cocaine
response to drug
response to histamine
response to morphine
social behavior
synaptic transmission, dopaminergic
visual learning - Gene Ontology Biological Process:
- acid secretion
adenylate cyclase-activating dopamine receptor signaling pathway
adenylate cyclase-inhibiting dopamine receptor signaling pathway
arachidonic acid secretion
behavioral response to cocaine
cellular calcium ion homeostasis
circadian regulation of gene expression
dopamine metabolic process
gastric emptying
G-protein coupled receptor internalization
G-protein coupled receptor signaling pathway
learning
learning or memory
locomotory behavior
musculoskeletal movement, spinal reflex action
negative regulation of adenylate cyclase activity
negative regulation of blood pressure
negative regulation of dopamine receptor signaling pathway
negative regulation of oligodendrocyte differentiation
negative regulation of protein kinase B signaling
negative regulation of protein secretion
negative regulation of sodium:proton antiporter activity
negative regulation of transcription from RNA polymerase II promoter
positive regulation of cell proliferation
positive regulation of cytokinesis
positive regulation of dopamine receptor signaling pathway
positive regulation of mitotic nuclear division
positive regulation of renal sodium excretion
positive regulation of transcription from RNA polymerase II promoter
prepulse inhibition
regulation of blood volume by renin-angiotensin
regulation of cAMP metabolic process
regulation of circadian sleep/wake cycle, sleep
regulation of dopamine secretion
regulation of dopamine uptake involved in synaptic transmission
regulation of lipid metabolic process
regulation of locomotion involved in locomotory behavior
regulation of multicellular organism growth
response to amphetamine
response to cocaine
response to drug
response to histamine
response to morphine
social behavior
synaptic transmission, dopaminergic
visual learning - Gene Ontology Molecular Function:
- dopamine binding
dopamine neurotransmitter receptor activity, coupled via Gi/Go
dopamine neurotransmitter receptor activity, coupled via Gs
drug binding - Gene Ontology Cellular Component:
- apical part of cell
cell projection
endocytic vesicle
integral component of plasma membrane
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
Disulfide bond
G-protein coupled receptor
Glycoprotein
Membrane
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix