Names & Taxonomy
- Uniprot ID:
- P35368
- Entry Name:
- ADA1B_HUMAN
- Status:
- reviewed
- Protein Names:
- Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor) (Alpha-1B adrenoceptor)
- Gene Names:
- ADRA1B
- Gene Names Primary:
- ADRA1B
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 520
- Sequence:
- MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Note=Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.
Function
- Function:
- This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
- Cross Reference Drug Bank:
- DB01614 DB00346 DB00321 DB00543 DB00182 DB01238 DB09128 DB01200 DB00248 DB01136 DB00477 DB00575 DB00363 DB00298 DB01151 DB01576 DB00590 DB01142 DB04855 DB06262 DB00668 DB01049 DB00696 DB00800 DB00458 DB00598 DB01255 DB00408 DB00934 DB01365 DB01403 DB00723 DB06148 DB00211 DB00370 DB00745 DB01149 DB00622 DB00368 DB00540 DB00334 DB00935 DB01267 DB01186 DB01579 DB00925 DB00388 DB00457 DB00420 DB01608 DB00777 DB01224 DB00734 DB06144 DB06207 DB00706 DB01162 DB01622 DB00679 DB00726 DB06694 DB00246
- Gene Ontology Go:
- integral component of plasma membrane
nuclear membrane
nucleus
plasma membrane
alpha1-adrenergic receptor activity
protein heterodimerization activity
adenylate cyclase-activating adrenergic receptor signaling pathway
adenylate cyclase-modulating G-protein coupled receptor signaling pathway
cell proliferation
cell-cell signaling
G-protein coupled receptor signaling pathway
glucose homeostasis
intracellular signal transduction
multicellular organism development
norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure
phospholipase C-activating G-protein coupled receptor signaling pathway
positive regulation of cytosolic calcium ion concentration
positive regulation of MAPK cascade
positive regulation of smooth muscle contraction
positive regulation of vasoconstriction
regulation of cardiac muscle contraction - Gene Ontology Biological Process:
- adenylate cyclase-activating adrenergic receptor signaling pathway
adenylate cyclase-modulating G-protein coupled receptor signaling pathway
cell-cell signaling
cell proliferation
glucose homeostasis
G-protein coupled receptor signaling pathway
intracellular signal transduction
multicellular organism development
norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure
phospholipase C-activating G-protein coupled receptor signaling pathway
positive regulation of cytosolic calcium ion concentration
positive regulation of MAPK cascade
positive regulation of smooth muscle contraction
positive regulation of vasoconstriction
regulation of cardiac muscle contraction - Gene Ontology Molecular Function:
- alpha1-adrenergic receptor activity
protein heterodimerization activity - Gene Ontology Cellular Component:
- integral component of plasma membrane
nuclear membrane
nucleus
plasma membrane - Keywords:
- Cell membrane
Complete proteome
Disulfide bond
G-protein coupled receptor
Glycoprotein
Lipoprotein
Membrane
Nucleus
Palmitate
Phosphoprotein
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix