Names & Taxonomy
- Uniprot ID:
- P32321
- Entry Name:
- DCTD_HUMAN
- Status:
- reviewed
- Protein Names:
- Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase)
- Gene Names:
- DCTD
- Gene Names Primary:
- DCTD
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 178
- Sequence:
- MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
- Proteomes:
- UP000005640
Function
- Function:
- Supplies the nucleotide substrate for thymidylate synthetase.
- Catalytic Activity:
- dCMP + H(2)O = dUMP + NH(3).
- Cofactor:
- COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
- Enzyme Regulation:
- ENZYME REGULATION: Allosteric enzyme whose activity is greatly influenced by the end products of its metabolic pathway, dCTP and dTTP.
- Active Site:
- ACT_SITE 86 86 Proton donor.
- Cross Reference Drug Bank:
- DB00987
- Gene Ontology Go:
- cytosol
extracellular exosome
dCMP deaminase activity
zinc ion binding
nucleobase-containing small molecule metabolic process
nucleotide biosynthetic process
pyrimidine nucleobase metabolic process
pyrimidine nucleoside biosynthetic process
pyrimidine nucleotide metabolic process
small molecule metabolic process - Gene Ontology Biological Process:
- nucleobase-containing small molecule metabolic process
nucleotide biosynthetic process
pyrimidine nucleobase metabolic process
pyrimidine nucleoside biosynthetic process
pyrimidine nucleotide metabolic process
small molecule metabolic process - Gene Ontology Molecular Function:
- dCMP deaminase activity
zinc ion binding - Gene Ontology Cellular Component:
- cytosol
extracellular exosome - Keywords:
- 3D-structure
Allosteric enzyme
Alternative splicing
Complete proteome
Direct protein sequencing
Hydrolase
Metal-binding
Nucleotide biosynthesis
Reference proteome
Zinc - Interacts With:
- P61328; Q9H8Y8; Q96EH3; O00560; Q99757