Names & Taxonomy
- Uniprot ID:
- P30542
- Entry Name:
- AA1R_HUMAN
- Status:
- reviewed
- Protein Names:
- Adenosine receptor A1
- Gene Names:
- ADORA1
- Gene Names Primary:
- ADORA1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 326
- Sequence:
- MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane; Multi-pass membrane protein.
Function
- Function:
- Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
- Cross Reference Drug Bank:
- DB00640 DB01223 DB00201 DB04932 DB00651 DB00824 DB00996 DB01303 DB00806 DB01412 DB00277
- Gene Ontology Go:
- asymmetric synapse
axolemma
basolateral plasma membrane
dendritic spine
endoplasmic reticulum
integral component of plasma membrane
neuronal cell body
plasma membrane
postsynaptic density
postsynaptic membrane
presynaptic active zone
presynaptic membrane
terminal bouton
G-protein coupled adenosine receptor activity
phospholipase C activity
purine nucleoside binding
activation of MAPKK activity
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
apoptotic signaling pathway
cell-cell signaling
cognition
detection of temperature stimulus involved in sensory perception of pain
excitatory postsynaptic potential
inflammatory response
lipid catabolic process
negative regulation of acute inflammatory response
negative regulation of apoptotic process
negative regulation of blood pressure
negative regulation of cardiac muscle contraction
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, non-REM sleep
negative regulation of glutamate secretion
negative regulation of hormone secretion
negative regulation of leukocyte migration
negative regulation of lipid catabolic process
negative regulation of long term synaptic depression
negative regulation of mucus secretion
negative regulation of neurotrophin production
negative regulation of renal sodium excretion
negative regulation of synaptic transmission, GABAergic
negative regulation of synaptic transmission, glutamatergic
negative regulation of vasodilation
nervous system development
phagocytosis
positive regulation of blood pressure
positive regulation of epidermal growth factor-activated receptor activity
positive regulation of nucleoside transport
positive regulation of peptide secretion
positive regulation of potassium ion transport
positive regulation of protein dephosphorylation
protein targeting to membrane
regulation of glomerular filtration
regulation of respiratory gaseous exchange by neurological system process
regulation of sensory perception of pain
relaxation of vascular smooth muscle
response to hypoxia
signal transduction
temperature homeostasis - Gene Ontology Biological Process:
- activation of MAPKK activity
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
apoptotic signaling pathway
cell-cell signaling
cognition
detection of temperature stimulus involved in sensory perception of pain
excitatory postsynaptic potential
inflammatory response
lipid catabolic process
negative regulation of acute inflammatory response
negative regulation of apoptotic process
negative regulation of blood pressure
negative regulation of cardiac muscle contraction
negative regulation of cell proliferation
negative regulation of circadian sleep/wake cycle, non-REM sleep
negative regulation of glutamate secretion
negative regulation of hormone secretion
negative regulation of leukocyte migration
negative regulation of lipid catabolic process
negative regulation of long term synaptic depression
negative regulation of mucus secretion
negative regulation of neurotrophin production
negative regulation of renal sodium excretion
negative regulation of synaptic transmission, GABAergic
negative regulation of synaptic transmission, glutamatergic
negative regulation of vasodilation
nervous system development
phagocytosis
positive regulation of blood pressure
positive regulation of epidermal growth factor-activated receptor activity
positive regulation of nucleoside transport
positive regulation of peptide secretion
positive regulation of potassium ion transport
positive regulation of protein dephosphorylation
protein targeting to membrane
regulation of glomerular filtration
regulation of respiratory gaseous exchange by neurological system process
regulation of sensory perception of pain
relaxation of vascular smooth muscle
response to hypoxia
signal transduction
temperature homeostasis - Gene Ontology Molecular Function:
- G-protein coupled adenosine receptor activity
phospholipase C activity
purine nucleoside binding - Gene Ontology Cellular Component:
- asymmetric synapse
axolemma
basolateral plasma membrane
dendritic spine
endoplasmic reticulum
integral component of plasma membrane
neuronal cell body
plasma membrane
postsynaptic density
postsynaptic membrane
presynaptic active zone
presynaptic membrane
terminal bouton - Keywords:
- Alternative splicing
Cell membrane
Complete proteome
Disulfide bond
G-protein coupled receptor
Glycoprotein
Lipoprotein
Membrane
Palmitate
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix - Interacts With:
- P29274