Names & Taxonomy
- Uniprot ID:
- P30273
- Entry Name:
- FCERG_HUMAN
- Status:
- reviewed
- Protein Names:
- High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
- Gene Names:
- FCER1G
- Gene Names Primary:
- FCER1G
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 86
- Sequence:
- MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
- Cross Reference Drug Bank:
- DB00895
- Gene Ontology Go:
- cell surface
external side of plasma membrane
Fc-epsilon receptor I complex
integral component of plasma membrane
plasma membrane
IgE binding
IgE receptor activity
IgG binding
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class II
blood coagulation
cellular response to low-density lipoprotein particle stimulus
defense response to bacterium
Fc receptor mediated stimulatory signaling pathway
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway
immunoglobulin mediated immune response
innate immune response
integrin-mediated signaling pathway
leukocyte migration
mast cell activation
negative regulation of mast cell apoptotic process
neutrophil activation involved in immune response
neutrophil chemotaxis
phagocytosis, engulfment
platelet activation
positive regulation of interleukin-10 production
positive regulation of interleukin-6 production
positive regulation of mast cell cytokine production
positive regulation of mast cell degranulation
positive regulation of phagocytosis
positive regulation of tumor necrosis factor production
positive regulation of type I hypersensitivity
positive regulation of type IIa hypersensitivity
positive regulation of type III hypersensitivity
protein localization to plasma membrane
receptor internalization
regulation of platelet activation
serotonin secretion by platelet
stimulatory C-type lectin receptor signaling pathway
T cell differentiation involved in immune response - Gene Ontology Biological Process:
- antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class II
blood coagulation
cellular response to low-density lipoprotein particle stimulus
defense response to bacterium
Fc-epsilon receptor signaling pathway
Fc-gamma receptor signaling pathway
Fc receptor mediated stimulatory signaling pathway
immunoglobulin mediated immune response
innate immune response
integrin-mediated signaling pathway
leukocyte migration
mast cell activation
negative regulation of mast cell apoptotic process
neutrophil activation involved in immune response
neutrophil chemotaxis
phagocytosis, engulfment
platelet activation
positive regulation of interleukin-10 production
positive regulation of interleukin-6 production
positive regulation of mast cell cytokine production
positive regulation of mast cell degranulation
positive regulation of phagocytosis
positive regulation of tumor necrosis factor production
positive regulation of type I hypersensitivity
positive regulation of type IIa hypersensitivity
positive regulation of type III hypersensitivity
protein localization to plasma membrane
receptor internalization
regulation of platelet activation
serotonin secretion by platelet
stimulatory C-type lectin receptor signaling pathway
T cell differentiation involved in immune response - Gene Ontology Molecular Function:
- IgE binding
IgE receptor activity
IgG binding - Gene Ontology Cellular Component:
- cell surface
external side of plasma membrane
Fc-epsilon receptor I complex
integral component of plasma membrane
plasma membrane - Keywords:
- Cell membrane
Complete proteome
Disulfide bond
IgE-binding protein
Membrane
Phosphoprotein
Receptor
Reference proteome
Signal
Transmembrane
Transmembrane helix - Interacts With:
- P43405