Names & Taxonomy
- Uniprot ID:
- P28566
- Entry Name:
- 5HT1E_HUMAN
- Status:
- reviewed
- Protein Names:
- 5-hydroxytryptamine receptor 1E (5-HT-1E) (5-HT1E) (S31) (Serotonin receptor 1E)
- Gene Names:
- HTR1E
- Gene Names Primary:
- HTR1E
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 365
- Sequence:
- MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
- Cross Reference Drug Bank:
- DB01238 DB00363 DB00216 DB01049 DB01221 DB00408 DB00247 DB00334 DB01224 DB00246
- Gene Ontology Go:
- integral component of plasma membrane
plasma membrane
G-protein coupled receptor activity
G-protein coupled serotonin receptor activity
serotonin binding
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
negative regulation of cAMP metabolic process
serotonin receptor signaling pathway
synaptic transmission - Gene Ontology Biological Process:
- adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway
G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
negative regulation of cAMP metabolic process
serotonin receptor signaling pathway
synaptic transmission - Gene Ontology Molecular Function:
- G-protein coupled receptor activity
G-protein coupled serotonin receptor activity
serotonin binding - Gene Ontology Cellular Component:
- integral component of plasma membrane
plasma membrane - Keywords:
- Cell membrane
Complete proteome
Disulfide bond
G-protein coupled receptor
Glycoprotein
Membrane
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix - Interacts With:
- A4D127