Names & Taxonomy
- Uniprot ID:
- P28065
- Entry Name:
- PSB9_HUMAN
- Status:
- reviewed
- Protein Names:
- Proteasome subunit beta type-9 (EC 3.4.25.1) (Low molecular mass protein 2) (Macropain chain 7) (Multicatalytic endopeptidase complex chain 7) (Proteasome chain 7) (Proteasome subunit beta-1i) (Really interesting new gene 12 protein)
- Gene Names:
- PSMB9 LMP2 PSMB6i RING12
- Gene Names Primary:
- PSMB9
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 219
- Sequence:
- MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm
Function
- Function:
- The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
- Catalytic Activity:
- Cleavage of peptide bonds with very broad specificity.
- Active Site:
- ACT_SITE 21 21 Nucleophile.
- Cross Reference Drug Bank:
- DB08889
- Gene Ontology Go:
- cytoplasm
cytosol
extracellular exosome
nucleoplasm
proteasome complex
proteasome core complex
spermatoproteasome complex
threonine-type endopeptidase activity
activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
cellular response to electrical stimulus
cellular response to interleukin-1
cellular response to virus
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
liver development
MAPK cascade
mitotic cell cycle
muscle atrophy
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of cysteine-type endopeptidase activity
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
response to alkaloid
response to benzene
response to drug
small GTPase mediated signal transduction
small molecule metabolic process
spleen development
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
thymus development
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Biological Process:
- activation of MAPKK activity
anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process
antigen processing and presentation of exogenous peptide antigen via MHC class I
antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent
antigen processing and presentation of peptide antigen via MHC class I
apoptotic process
axon guidance
cellular nitrogen compound metabolic process
cellular response to electrical stimulus
cellular response to interleukin-1
cellular response to virus
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
G1/S transition of mitotic cell cycle
gene expression
innate immune response
insulin receptor signaling pathway
liver development
MAPK cascade
mitotic cell cycle
muscle atrophy
negative regulation of apoptotic process
negative regulation of canonical Wnt signaling pathway
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
neurotrophin TRK receptor signaling pathway
NIK/NF-kappaB signaling
polyamine metabolic process
positive regulation of canonical Wnt signaling pathway
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
programmed cell death
protein polyubiquitination
Ras protein signal transduction
regulation of apoptotic process
regulation of cellular amino acid metabolic process
regulation of cysteine-type endopeptidase activity
regulation of mRNA stability
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
response to alkaloid
response to benzene
response to drug
small GTPase mediated signal transduction
small molecule metabolic process
spleen development
stimulatory C-type lectin receptor signaling pathway
T cell receptor signaling pathway
thymus development
tumor necrosis factor-mediated signaling pathway
vascular endothelial growth factor receptor signaling pathway
viral process - Gene Ontology Molecular Function:
- threonine-type endopeptidase activity
- Gene Ontology Cellular Component:
- cytoplasm
cytosol
extracellular exosome
nucleoplasm
proteasome complex
proteasome core complex
spermatoproteasome complex - Keywords:
- Acetylation
Alternative splicing
Complete proteome
Cytoplasm
Host-virus interaction
Hydrolase
Immunity
Nucleus
Polymorphism
Protease
Proteasome
Reference proteome
Threonine protease
Zymogen - Interacts With:
- Q9WMX2; Q9Y3R0; Q15788; Q9Y6Q9; Q99436