Names & Taxonomy
- Uniprot ID:
- P27658
- Entry Name:
- CO8A1_HUMAN
- Status:
- reviewed
- Protein Names:
- Collagen alpha-1(VIII) chain (Endothelial collagen) [Cleaved into: Vastatin]
- Gene Names:
- COL8A1 C3orf7
- Gene Names Primary:
- COL8A1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 744
- Sequence:
- MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space, extracellular matrix, basement membrane.
Function
- Function:
- Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis.
- Gene Ontology Go:
- collagen type VIII trimer
endoplasmic reticulum lumen
extracellular exosome
extracellular region
intracellular membrane-bounded organelle
angiogenesis
camera-type eye morphogenesis
cell adhesion
collagen catabolic process
endodermal cell differentiation
epithelial cell proliferation
extracellular matrix disassembly
extracellular matrix organization
positive regulation of cell-substrate adhesion - Gene Ontology Biological Process:
- angiogenesis
camera-type eye morphogenesis
cell adhesion
collagen catabolic process
endodermal cell differentiation
epithelial cell proliferation
extracellular matrix disassembly
extracellular matrix organization
positive regulation of cell-substrate adhesion - Gene Ontology Cellular Component:
- collagen type VIII trimer
endoplasmic reticulum lumen
extracellular exosome
extracellular region
intracellular membrane-bounded organelle - Keywords:
- Angiogenesis
Basement membrane
Cell adhesion
Collagen
Complete proteome
Extracellular matrix
Hydroxylation
Reference proteome
Repeat
Secreted
Signal - Interacts With:
- Q02930-3; Q0VD86; Q6A162; P60409; P60410; Q6PEX3; Q9BYQ4; Q7Z3S9; Q04864; Q02446; Q08AM6