Names & Taxonomy
- Uniprot ID:
- P27449
- Entry Name:
- VATL_HUMAN
- Status:
- reviewed
- Protein Names:
- V-type proton ATPase 16 kDa proteolipid subunit (V-ATPase 16 kDa proteolipid subunit) (Vacuolar proton pump 16 kDa proteolipid subunit)
- Gene Names:
- ATP6V0C ATP6C ATP6L ATPL
- Gene Names Primary:
- ATP6V0C
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 155
- Sequence:
- MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Vacuole membrane; Multi-pass membrane protein.
Function
- Function:
- Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
- Gene Ontology Go:
- endosome membrane
extracellular exosome
focal adhesion
integral component of membrane
lysosomal membrane
phagocytic vesicle membrane
vacuolar proton-transporting V-type ATPase, V0 domain
proton-transporting ATP synthase activity, rotational mechanism
proton-transporting ATPase activity, rotational mechanism
ubiquitin protein ligase binding
ATP hydrolysis coupled proton transport
cell redox homeostasis
cellular iron ion homeostasis
insulin receptor signaling pathway
ion transmembrane transport
lysosomal lumen acidification
positive regulation of Wnt signaling pathway
proton transport
regulation of macroautophagy
transferrin transport
transmembrane transport
viral process - Gene Ontology Biological Process:
- ATP hydrolysis coupled proton transport
cell redox homeostasis
cellular iron ion homeostasis
insulin receptor signaling pathway
ion transmembrane transport
lysosomal lumen acidification
positive regulation of Wnt signaling pathway
proton transport
regulation of macroautophagy
transferrin transport
transmembrane transport
viral process - Gene Ontology Molecular Function:
- proton-transporting ATPase activity, rotational mechanism
proton-transporting ATP synthase activity, rotational mechanism
ubiquitin protein ligase binding - Gene Ontology Cellular Component:
- endosome membrane
extracellular exosome
focal adhesion
integral component of membrane
lysosomal membrane
phagocytic vesicle membrane
vacuolar proton-transporting V-type ATPase, V0 domain - Keywords:
- Complete proteome
Host-virus interaction
Hydrogen ion transport
Ion transport
Membrane
Reference proteome
Transmembrane
Transmembrane helix
Transport
Ubl conjugation
Vacuole - Interacts With:
- Q96G23; P0CK45; Q92838; P21757; P25788; Q9BZL3