Names & Taxonomy
- Uniprot ID:
- P21918
- Entry Name:
- DRD5_HUMAN
- Status:
- reviewed
- Protein Names:
- D(1B) dopamine receptor (D(5) dopamine receptor) (D1beta dopamine receptor) (Dopamine D5 receptor)
- Gene Names:
- DRD5 DRD1B DRD1L2
- Gene Names Primary:
- DRD5
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 477
- Sequence:
- MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane; Multi-pass membrane protein.
Function
- Function:
- Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
- Cross Reference Drug Bank:
- DB00714 DB01238 DB01200 DB00248 DB00477 DB00568 DB00988 DB00696 DB00800 DB00458 DB01235 DB00589 DB00408 DB01403 DB06148 DB00370 DB00334 DB01186 DB00413 DB01224 DB00268 DB05271 DB00726 DB00246 DB01624
- Gene Ontology Go:
- brush border membrane
ciliary membrane
integral component of plasma membrane
nonmotile primary cilium
plasma membrane
dopamine binding
dopamine neurotransmitter receptor activity
dopamine neurotransmitter receptor activity, coupled via Gs
activation of adenylate cyclase activity
adenylate cyclase-activating dopamine receptor signaling pathway
adenylate cyclase-activating G-protein coupled receptor signaling pathway
associative learning
cellular calcium ion homeostasis
cellular response to catecholamine stimulus
learning
long term synaptic depression
negative regulation of blood pressure
negative regulation of NAD(P)H oxidase activity
norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure
phospholipase C-activating dopamine receptor signaling pathway
positive regulation of adenylate cyclase activity
positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
reactive oxygen species metabolic process
regulation of female receptivity
regulation of systemic arterial blood pressure by vasopressin
response to amphetamine
response to cocaine
sensitization
synaptic transmission
synaptic transmission, dopaminergic
transmission of nerve impulse
wound healing - Gene Ontology Biological Process:
- activation of adenylate cyclase activity
adenylate cyclase-activating dopamine receptor signaling pathway
adenylate cyclase-activating G-protein coupled receptor signaling pathway
associative learning
cellular calcium ion homeostasis
cellular response to catecholamine stimulus
learning
long term synaptic depression
negative regulation of blood pressure
negative regulation of NAD(P)H oxidase activity
norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure
phospholipase C-activating dopamine receptor signaling pathway
positive regulation of adenylate cyclase activity
positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
reactive oxygen species metabolic process
regulation of female receptivity
regulation of systemic arterial blood pressure by vasopressin
response to amphetamine
response to cocaine
sensitization
synaptic transmission
synaptic transmission, dopaminergic
transmission of nerve impulse
wound healing - Gene Ontology Molecular Function:
- dopamine binding
dopamine neurotransmitter receptor activity
dopamine neurotransmitter receptor activity, coupled via Gs - Gene Ontology Cellular Component:
- brush border membrane
ciliary membrane
integral component of plasma membrane
nonmotile primary cilium
plasma membrane - Keywords:
- Cell membrane
Complete proteome
Disulfide bond
Dystonia
G-protein coupled receptor
Glycoprotein
Lipoprotein
Membrane
Palmitate
Polymorphism
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix