Names & Taxonomy
- Uniprot ID:
- P21554
- Entry Name:
- CNR1_HUMAN
- Status:
- reviewed
- Protein Names:
- Cannabinoid receptor 1 (CB-R) (CB1) (CANN6)
- Gene Names:
- CNR1 CNR
- Gene Names Primary:
- CNR1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 472
- Sequence:
- MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane; Multi-pass membrane protein.
Function
- Function:
- Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding.
- Cross Reference Drug Bank:
- DB00470 DB00486 DB06155
- Gene Ontology Go:
- axon
growth cone
integral component of plasma membrane
intracellular membrane-bounded organelle
membrane raft
plasma membrane
cannabinoid receptor activity
drug binding
adenylate cyclase-modulating G-protein coupled receptor signaling pathway
aging
axonal fasciculation
G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
glucose homeostasis
maternal process involved in female pregnancy
memory
negative regulation of action potential
negative regulation of blood pressure
negative regulation of dopamine secretion
negative regulation of fatty acid beta-oxidation
negative regulation of mast cell activation
negative regulation of nitric-oxide synthase activity
positive regulation of acute inflammatory response to antigenic stimulus
positive regulation of apoptotic process
positive regulation of blood pressure
positive regulation of fever generation
positive regulation of neuron projection development
regulation of feeding behavior
regulation of insulin secretion
regulation of penile erection
regulation of synaptic transmission, GABAergic
regulation of synaptic transmission, glutamatergic
response to cocaine
response to ethanol
response to lipopolysaccharide
response to morphine
response to nicotine
response to nutrient
sensory perception of pain
spermatogenesis - Gene Ontology Biological Process:
- adenylate cyclase-modulating G-protein coupled receptor signaling pathway
aging
axonal fasciculation
glucose homeostasis
G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
maternal process involved in female pregnancy
memory
negative regulation of action potential
negative regulation of blood pressure
negative regulation of dopamine secretion
negative regulation of fatty acid beta-oxidation
negative regulation of mast cell activation
negative regulation of nitric-oxide synthase activity
positive regulation of acute inflammatory response to antigenic stimulus
positive regulation of apoptotic process
positive regulation of blood pressure
positive regulation of fever generation
positive regulation of neuron projection development
regulation of feeding behavior
regulation of insulin secretion
regulation of penile erection
regulation of synaptic transmission, GABAergic
regulation of synaptic transmission, glutamatergic
response to cocaine
response to ethanol
response to lipopolysaccharide
response to morphine
response to nicotine
response to nutrient
sensory perception of pain
spermatogenesis - Gene Ontology Molecular Function:
- cannabinoid receptor activity
drug binding - Gene Ontology Cellular Component:
- axon
growth cone
integral component of plasma membrane
intracellular membrane-bounded organelle
membrane raft
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
G-protein coupled receptor
Glycoprotein
Lipoprotein
Membrane
Palmitate
Phosphoprotein
Receptor
Reference proteome
Transducer
Transmembrane
Transmembrane helix