Names & Taxonomy
- Uniprot ID:
- P19784
- Entry Name:
- CSK22_HUMAN
- Status:
- reviewed
- Protein Names:
- Casein kinase II subunit alpha' (CK II alpha') (EC 2.7.11.1)
- Gene Names:
- CSNK2A2 CK2A2
- Gene Names Primary:
- CSNK2A2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 350
- Sequence:
- MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
- Proteomes:
- UP000005640
Function
- Function:
- Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV.
- Catalytic Activity:
- ATP + a protein = ADP + a phosphoprotein.
- Enzyme Regulation:
- ENZYME REGULATION: Constitutively active protein kinase whose activity is not directly affected by phosphorylation. Seems to be regulated by level of expression and localization (By similarity).
- Active Site:
- ACT_SITE 157 157 Proton acceptor.
- Gene Ontology Go:
- cytosol
nucleus
ATP binding
protein N-terminus binding
protein serine/threonine kinase activity
apoptotic process
axon guidance
mitotic cell cycle
mitotic spindle checkpoint
positive regulation of protein targeting to mitochondrion
regulation of mitophagy
regulation of transcription, DNA-templated
transcription, DNA-templated
Wnt signaling pathway - Gene Ontology Biological Process:
- apoptotic process
axon guidance
mitotic cell cycle
mitotic spindle checkpoint
positive regulation of protein targeting to mitochondrion
regulation of mitophagy
regulation of transcription, DNA-templated
transcription, DNA-templated
Wnt signaling pathway - Gene Ontology Molecular Function:
- ATP binding
protein N-terminus binding
protein serine/threonine kinase activity - Gene Ontology Cellular Component:
- cytosol
nucleus - Keywords:
- 3D-structure
ATP-binding
Acetylation
Apoptosis
Cell cycle
Complete proteome
Kinase
Nucleotide-binding
Phosphoprotein
Polymorphism
Reference proteome
Serine/threonine-protein kinase
Transcription
Transcription regulation
Transferase
Wnt signaling pathway - Interacts With:
- P68400; P67870; O60282; Q8WV44