Names & Taxonomy
- Uniprot ID:
- P19099
- Entry Name:
- C11B2_HUMAN
- Status:
- reviewed
- Protein Names:
- Cytochrome P450 11B2, mitochondrial (Aldosterone synthase) (ALDOS) (EC 1.14.15.4) (EC 1.14.15.5) (Aldosterone-synthesizing enzyme) (CYPXIB2) (Cytochrome P-450Aldo) (Cytochrome P-450C18) (Steroid 18-hydroxylase)
- Gene Names:
- CYP11B2
- Gene Names Primary:
- CYP11B2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 503
- Sequence:
- MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Mitochondrion membrane.
Function
- Function:
- Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.
- Catalytic Activity:
- A steroid + 2 reduced adrenodoxin + O(2) + 2 H(+) = an 11-beta- hydroxysteroid + 2 oxidized adrenodoxin + H(2)O.
- Cofactor:
- COFACTOR: Name=heme; Xref=ChEBI:CHEBI:30413;
- Cross Reference Drug Bank:
- DB00700 DB00292 DB00741 DB01233 DB01011 DB00421
- Gene Ontology Go:
- mitochondrial inner membrane
mitochondrion
corticosterone 18-monooxygenase activity
heme binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
steroid 11-beta-monooxygenase activity
aldosterone biosynthetic process
C21-steroid hormone biosynthetic process
cellular response to hormone stimulus
cellular response to peptide hormone stimulus
cellular response to potassium ion
cholesterol metabolic process
cortisol biosynthetic process
mineralocorticoid biosynthetic process
potassium ion homeostasis
regulation of blood volume by renal aldosterone
renal water homeostasis
secondary metabolite biosynthetic process
small molecule metabolic process
sodium ion homeostasis
steroid metabolic process
sterol metabolic process
xenobiotic metabolic process - Gene Ontology Biological Process:
- aldosterone biosynthetic process
C21-steroid hormone biosynthetic process
cellular response to hormone stimulus
cellular response to peptide hormone stimulus
cellular response to potassium ion
cholesterol metabolic process
cortisol biosynthetic process
mineralocorticoid biosynthetic process
potassium ion homeostasis
regulation of blood volume by renal aldosterone
renal water homeostasis
secondary metabolite biosynthetic process
small molecule metabolic process
sodium ion homeostasis
steroid metabolic process
sterol metabolic process
xenobiotic metabolic process - Gene Ontology Molecular Function:
- corticosterone 18-monooxygenase activity
heme binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
steroid 11-beta-monooxygenase activity - Gene Ontology Cellular Component:
- mitochondrial inner membrane
mitochondrion - Keywords:
- 3D-structure
Complete proteome
Disease mutation
Heme
Iron
Lipid metabolism
Membrane
Metal-binding
Mitochondrion
Monooxygenase
Oxidoreductase
Polymorphism
Reference proteome
Steroid metabolism
Steroidogenesis
Transit peptide