Names & Taxonomy
- Uniprot ID:
- P17931
- Entry Name:
- LEG3_HUMAN
- Status:
- reviewed
- Protein Names:
- Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
- Gene Names:
- LGALS3 MAC2
- Gene Names Primary:
- LGALS3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 250
- Sequence:
- MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm. Nucleus. Secreted. Note=Secreted by a non-classical secretory pathway and associates with the cell surface.
Function
- Function:
- Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity). In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells.
- Gene Ontology Go:
- cytoplasm
extracellular exosome
extracellular space
immunological synapse
membrane
mitochondrial inner membrane
nucleus
plasma membrane
spliceosomal complex
carbohydrate binding
chemoattractant activity
IgE binding
laminin binding
poly(A) RNA binding
eosinophil chemotaxis
epithelial cell differentiation
innate immune response
macrophage chemotaxis
monocyte chemotaxis
mononuclear cell migration
mRNA processing
negative regulation of endocytosis
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of immunological synapse formation
negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
negative regulation of T cell receptor signaling pathway
neutrophil chemotaxis
positive chemotaxis
positive regulation of calcium ion import
positive regulation of mononuclear cell migration
regulation of extrinsic apoptotic signaling pathway via death domain receptors
regulation of T cell apoptotic process
regulation of T cell proliferation
RNA splicing - Gene Ontology Biological Process:
- eosinophil chemotaxis
epithelial cell differentiation
innate immune response
macrophage chemotaxis
monocyte chemotaxis
mononuclear cell migration
mRNA processing
negative regulation of endocytosis
negative regulation of extrinsic apoptotic signaling pathway
negative regulation of immunological synapse formation
negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell
negative regulation of T cell receptor signaling pathway
neutrophil chemotaxis
positive chemotaxis
positive regulation of calcium ion import
positive regulation of mononuclear cell migration
regulation of extrinsic apoptotic signaling pathway via death domain receptors
regulation of T cell apoptotic process
regulation of T cell proliferation
RNA splicing - Gene Ontology Molecular Function:
- carbohydrate binding
chemoattractant activity
IgE binding
laminin binding
poly(A) RNA binding - Gene Ontology Cellular Component:
- cytoplasm
extracellular exosome
extracellular space
immunological synapse
membrane
mitochondrial inner membrane
nucleus
plasma membrane
spliceosomal complex - Keywords:
- 3D-structure
Acetylation
Complete proteome
Cytoplasm
Differentiation
Disulfide bond
IgE-binding protein
Immunity
Innate immunity
Lectin
Nucleus
Phosphoprotein
Polymorphism
Reference proteome
Repeat
Secreted
Spliceosome
mRNA processing
mRNA splicing - Interacts With:
- P12763; Q13740; P30203; Q08379; Q29983; Q13427; Q9NZ81; O75177