Names & Taxonomy
- Uniprot ID:
- P16860
- Entry Name:
- ANFB_HUMAN
- Status:
- reviewed
- Protein Names:
- Natriuretic peptides B (Gamma-brain natriuretic peptide) [Cleaved into: Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32); BNP(3-30); BNP(3-29); BNP(4-32); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)]
- Gene Names:
- NPPB
- Gene Names Primary:
- NPPB
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 134
- Sequence:
- MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
- Cross Reference Drug Bank:
- DB01136 DB06412
- Gene Ontology Go:
- extracellular region
extracellular space
protein complex
diuretic hormone activity
hormone activity
receptor binding
body fluid secretion
cell surface receptor signaling pathway
cGMP biosynthetic process
negative regulation of angiogenesis
negative regulation of cell growth
positive regulation of renal sodium excretion
positive regulation of urine volume
receptor guanylyl cyclase signaling pathway
regulation of blood pressure
regulation of vascular permeability
regulation of vasodilation - Gene Ontology Biological Process:
- body fluid secretion
cell surface receptor signaling pathway
cGMP biosynthetic process
negative regulation of angiogenesis
negative regulation of cell growth
positive regulation of renal sodium excretion
positive regulation of urine volume
receptor guanylyl cyclase signaling pathway
regulation of blood pressure
regulation of vascular permeability
regulation of vasodilation - Gene Ontology Molecular Function:
- diuretic hormone activity
hormone activity
receptor binding - Gene Ontology Cellular Component:
- extracellular region
extracellular space
protein complex - Keywords:
- 3D-structure
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Hormone
Pharmaceutical
Polymorphism
Reference proteome
Secreted
Signal
Vasoactive - Interacts With:
- Q6A162; P60411; Q7Z3S9; P25788