Names & Taxonomy
- Uniprot ID:
- P16581
- Entry Name:
- LYAM2_HUMAN
- Status:
- reviewed
- Protein Names:
- E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
- Gene Names:
- SELE ELAM1
- Gene Names Primary:
- SELE
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 610
- Sequence:
- MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
- Cross Reference Drug Bank:
- DB01136
- Gene Ontology Go:
- caveola
coated pit
cortical cytoskeleton
extracellular space
integral component of membrane
membrane raft
perinuclear region of cytoplasm
plasma membrane
oligosaccharide binding
phospholipase binding
sialic acid binding
transmembrane signaling receptor activity
actin filament-based process
activation of phospholipase C activity
blood coagulation
calcium-mediated signaling
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
inflammatory response
leukocyte cell-cell adhesion
leukocyte migration
leukocyte migration involved in inflammatory response
leukocyte tethering or rolling
positive regulation of receptor internalization
regulation of inflammatory response
response to interleukin-1
response to lipopolysaccharide
response to tumor necrosis factor - Gene Ontology Biological Process:
- actin filament-based process
activation of phospholipase C activity
blood coagulation
calcium-mediated signaling
heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
inflammatory response
leukocyte cell-cell adhesion
leukocyte migration
leukocyte migration involved in inflammatory response
leukocyte tethering or rolling
positive regulation of receptor internalization
regulation of inflammatory response
response to interleukin-1
response to lipopolysaccharide
response to tumor necrosis factor - Gene Ontology Molecular Function:
- oligosaccharide binding
phospholipase binding
sialic acid binding
transmembrane signaling receptor activity - Gene Ontology Cellular Component:
- caveola
coated pit
cortical cytoskeleton
extracellular space
integral component of membrane
membrane raft
perinuclear region of cytoplasm
plasma membrane - Keywords:
- 3D-structure
Cell adhesion
Cell membrane
Complete proteome
Disulfide bond
EGF-like domain
Glycoprotein
Lectin
Membrane
Polymorphism
Reference proteome
Repeat
Signal
Sushi
Transmembrane
Transmembrane helix