Names & Taxonomy
- Uniprot ID:
- P16050
- Entry Name:
- LOX15_HUMAN
- Status:
- reviewed
- Protein Names:
- Arachidonate 15-lipoxygenase (15-LOX) (15-LOX-1) (EC 1.13.11.33) (12/15-lipoxygenase) (Arachidonate 12-lipoxygenase, leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate omega-6 lipoxygenase)
- Gene Names:
- ALOX15 LOG15
- Gene Names Primary:
- ALOX15
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 662
- Sequence:
- MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. Lipid droplet. Note=Predominantly cytosolic; becomes enriched at membranes upon calcium binding. Translocates from the cytosol to the plasma membrane when stimulated by IL13/interleukin-13 and in macrophages binding apoptotic cells.
Function
- Function:
- Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12-hydroperoxyeicosatetraenoic acid/12-HPETE and 15-hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)-hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through regulation of the peroxisome proliferator activated receptor signaling pathway. Finally, it is also involved in the cellular response to IL13/interleukin-13. In addition to its role in the immune and inflammatory responses, may play a role in epithelial wound healing in the cornea maybe through production of lipoxin A4. May also play a role in endoplasmic reticulum stress response and the regulation of bone mass.
- Pathway:
- Lipid metabolism; hydroperoxy eicosatetraenoic acid biosynthesis.
- Catalytic Activity:
- Arachidonate + O(2) = (5Z,8Z,10E,14Z)-(12S)-12-hydroperoxyicosa-5,8,10,14-tetraenoate.
- Cofactor:
- COFACTOR: Name=Fe cation; Xref=ChEBI:CHEBI:24875;
- Enzyme Regulation:
- ENZYME REGULATION: Activity is increased by binding phosphatidylinositol phosphates, especially phosphatidylinositol 3,4-bisphosphate and phosphatidylinositol 4,5-bisphosphate.
- Gene Ontology Go:
- cytosol
extrinsic component of cytoplasmic side of plasma membrane
lipid particle
membrane
plasma membrane
arachidonate 12-lipoxygenase activity
arachidonate 15-lipoxygenase activity
eoxin A4 synthase activity
hepoxilin A3 synthase activity
hepoxilin-epoxide hydrolase activity
iron ion binding
phosphatidylinositol-4,5-bisphosphate binding
apoptotic cell clearance
arachidonic acid metabolic process
bone mineralization
cellular response to calcium ion
cellular response to interleukin-13
hepoxilin biosynthetic process
inflammatory response
leukotriene metabolic process
lipoxin A4 biosynthetic process
lipoxygenase pathway
negative regulation of adaptive immune response
ossification
phosphatidylethanolamine biosynthetic process
positive regulation of actin filament polymerization
positive regulation of cell-substrate adhesion
positive regulation of ERK1 and ERK2 cascade
positive regulation of heterotypic cell-cell adhesion
regulation of engulfment of apoptotic cell
regulation of peroxisome proliferator activated receptor signaling pathway
response to endoplasmic reticulum stress
small molecule metabolic process
wound healing - Gene Ontology Biological Process:
- apoptotic cell clearance
arachidonic acid metabolic process
bone mineralization
cellular response to calcium ion
cellular response to interleukin-13
hepoxilin biosynthetic process
inflammatory response
leukotriene metabolic process
lipoxin A4 biosynthetic process
lipoxygenase pathway
negative regulation of adaptive immune response
ossification
phosphatidylethanolamine biosynthetic process
positive regulation of actin filament polymerization
positive regulation of cell-substrate adhesion
positive regulation of ERK1 and ERK2 cascade
positive regulation of heterotypic cell-cell adhesion
regulation of engulfment of apoptotic cell
regulation of peroxisome proliferator activated receptor signaling pathway
response to endoplasmic reticulum stress
small molecule metabolic process
wound healing - Gene Ontology Molecular Function:
- arachidonate 12-lipoxygenase activity
arachidonate 15-lipoxygenase activity
eoxin A4 synthase activity
hepoxilin A3 synthase activity
hepoxilin-epoxide hydrolase activity
iron ion binding
phosphatidylinositol-4,5-bisphosphate binding - Gene Ontology Cellular Component:
- cytosol
extrinsic component of cytoplasmic side of plasma membrane
lipid particle
membrane
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Calcium
Cell membrane
Complete proteome
Cytoplasm
Dioxygenase
Direct protein sequencing
Fatty acid metabolism
Iron
Lipid droplet
Lipid metabolism
Lipid-binding
Membrane
Metal-binding
Oxidoreductase
Polymorphism
Reference proteome