Names & Taxonomy
- Uniprot ID:
- P15153
- Entry Name:
- RAC2_HUMAN
- Status:
- reviewed
- Protein Names:
- Ras-related C3 botulinum toxin substrate 2 (GX) (Small G protein) (p21-Rac2)
- Gene Names:
- RAC2
- Gene Names Primary:
- RAC2
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 192
- Sequence:
- MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cytoplasm. Note=Membrane-associated when activated.
Function
- Function:
- Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.
- Enzyme Regulation:
- ENZYME REGULATION: Regulated by guanine nucleotide exchange factors (GEFs) which promote the exchange of bound GDP for free GTP, GTPase activating proteins (GAPs) which increase the GTP hydrolysis activity, and GDP dissociation inhibitors which inhibit the dissociation of the nucleotide from the GTPase.
- Cross Reference Drug Bank:
- DB00514
- Gene Ontology Go:
- cytosol
extracellular exosome
focal adhesion
lamellipodium
nuclear envelope
phagocytic vesicle membrane
plasma membrane
GTP binding
GTPase activity
protein kinase regulator activity
actin filament organization
axon guidance
blood coagulation
bone resorption
cell projection assembly
G-protein coupled receptor signaling pathway
lymphocyte aggregation
platelet activation
positive regulation of cell proliferation
positive regulation of lamellipodium assembly
positive regulation of neutrophil chemotaxis
positive regulation of protein targeting to mitochondrion
regulation of cell-substrate adhesion
regulation of hydrogen peroxide metabolic process
regulation of mast cell chemotaxis
regulation of mast cell degranulation
regulation of neutrophil migration
regulation of respiratory burst
regulation of small GTPase mediated signal transduction
regulation of T cell proliferation
signal transduction
small GTPase mediated signal transduction - Gene Ontology Biological Process:
- actin filament organization
axon guidance
blood coagulation
bone resorption
cell projection assembly
G-protein coupled receptor signaling pathway
lymphocyte aggregation
platelet activation
positive regulation of cell proliferation
positive regulation of lamellipodium assembly
positive regulation of neutrophil chemotaxis
positive regulation of protein targeting to mitochondrion
regulation of cell-substrate adhesion
regulation of hydrogen peroxide metabolic process
regulation of mast cell chemotaxis
regulation of mast cell degranulation
regulation of neutrophil migration
regulation of respiratory burst
regulation of small GTPase mediated signal transduction
regulation of T cell proliferation
signal transduction
small GTPase mediated signal transduction - Gene Ontology Molecular Function:
- GTPase activity
GTP binding
protein kinase regulator activity - Gene Ontology Cellular Component:
- cytosol
extracellular exosome
focal adhesion
lamellipodium
nuclear envelope
phagocytic vesicle membrane
plasma membrane - Keywords:
- 3D-structure
ADP-ribosylation
Acetylation
Complete proteome
Cytoplasm
Direct protein sequencing
Disease mutation
GTP-binding
Glycoprotein
Lipoprotein
Methylation
Nucleotide-binding
Polymorphism
Prenylation
Reference proteome