Names & Taxonomy
- Uniprot ID:
- P14780
- Entry Name:
- MMP9_HUMAN
- Status:
- reviewed
- Protein Names:
- Matrix metalloproteinase-9 (MMP-9) (EC 3.4.24.35) (92 kDa gelatinase) (92 kDa type IV collagenase) (Gelatinase B) (GELB) [Cleaved into: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9]
- Gene Names:
- MMP9 CLG4B
- Gene Names Primary:
- MMP9
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 707
- Sequence:
- MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted, extracellular space, extracellular matrix
Function
- Function:
- May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
- Catalytic Activity:
- Cleavage of gelatin types I and V and collagen types IV and V.
- Cofactor:
- COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; ; Note=Binds 2 Zn(2+) ions per subunit.;; COFACTOR: Name=Ca(2+); Xref=ChEBI:CHEBI:29108; ; Note=Binds 3 Ca(2+) ions per subunit.;
- Enzyme Regulation:
- ENZYME REGULATION: Inhibited by histatin-3 1/24 (histatin-5). Inhibited by ECM1.
- Active Site:
- ACT_SITE 402 402
- Cross Reference Drug Bank:
- DB01197 DB01296 DB00786 DB01017
- Gene Ontology Go:
- extracellular exosome
extracellular region
extracellular space
proteinaceous extracellular matrix
collagen binding
endopeptidase activity
identical protein binding
metalloendopeptidase activity
metallopeptidase activity
zinc ion binding
axon guidance
collagen catabolic process
embryo implantation
endodermal cell differentiation
ephrin receptor signaling pathway
extracellular matrix disassembly
extracellular matrix organization
leukocyte migration
macrophage differentiation
negative regulation of apoptotic process
negative regulation of cation channel activity
negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
negative regulation of intrinsic apoptotic signaling pathway
ossification
positive regulation of DNA binding
positive regulation of epidermal growth factor receptor signaling pathway
positive regulation of keratinocyte migration
positive regulation of protein phosphorylation
positive regulation of receptor binding
positive regulation of release of cytochrome c from mitochondria
proteolysis
skeletal system development - Gene Ontology Biological Process:
- axon guidance
collagen catabolic process
embryo implantation
endodermal cell differentiation
ephrin receptor signaling pathway
extracellular matrix disassembly
extracellular matrix organization
leukocyte migration
macrophage differentiation
negative regulation of apoptotic process
negative regulation of cation channel activity
negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
negative regulation of intrinsic apoptotic signaling pathway
ossification
positive regulation of DNA binding
positive regulation of epidermal growth factor receptor signaling pathway
positive regulation of keratinocyte migration
positive regulation of protein phosphorylation
positive regulation of receptor binding
positive regulation of release of cytochrome c from mitochondria
proteolysis
skeletal system development - Gene Ontology Molecular Function:
- collagen binding
endopeptidase activity
identical protein binding
metalloendopeptidase activity
metallopeptidase activity
zinc ion binding - Gene Ontology Cellular Component:
- extracellular exosome
extracellular region
extracellular space
proteinaceous extracellular matrix - Keywords:
- 3D-structure
Calcium
Collagen degradation
Complete proteome
Direct protein sequencing
Disulfide bond
Extracellular matrix
Glycoprotein
Hydrolase
Metal-binding
Metalloprotease
Polymorphism
Protease
Reference proteome
Repeat
Secreted
Signal
Zinc
Zymogen - Interacts With:
- Itself; Q16819; Q16820; Q8IX30; P01033; P13611