Names & Taxonomy
- Uniprot ID:
- P14555
- Entry Name:
- PA2GA_HUMAN
- Status:
- reviewed
- Protein Names:
- Phospholipase A2, membrane associated (EC 3.1.1.4) (GIIC sPLA2) (Group IIA phospholipase A2) (Non-pancreatic secretory phospholipase A2) (NPS-PLA2) (Phosphatidylcholine 2-acylhydrolase 2A)
- Gene Names:
- PLA2G2A PLA2B PLA2L RASF-A
- Gene Names Primary:
- PLA2G2A
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 144
- Sequence:
- MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Membrane; Peripheral membrane protein.
Function
- Function:
- Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
- Catalytic Activity:
- Phosphatidylcholine + H(2)O = 1-acylglycerophosphocholine + a carboxylate.
- Cofactor:
- COFACTOR: Name=Ca(2+); Xref=ChEBI:CHEBI:29108; ; Note=Binds 1 Ca(2+) ion per subunit.;
- Active Site:
- ACT_SITE 67 67
- Cross Reference Drug Bank:
- DB00586 DB01381 DB00328 DB02325 DB04786
- Gene Ontology Go:
- endoplasmic reticulum
endoplasmic reticulum membrane
extracellular exosome
extracellular region
extracellular space
perinuclear region of cytoplasm
secretory granule
calcium ion binding
calcium-dependent phospholipase A2 activity
phospholipase A2 activity
phospholipid binding
defense response to Gram-positive bacterium
glycerophospholipid biosynthetic process
lipid catabolic process
low-density lipoprotein particle remodeling
phosphatidic acid biosynthetic process
phosphatidic acid metabolic process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
phosphatidylglycerol acyl-chain remodeling
phosphatidylinositol acyl-chain remodeling
phosphatidylserine acyl-chain remodeling
phospholipid metabolic process
positive regulation of ERK1 and ERK2 cascade
positive regulation of inflammatory response
positive regulation of macrophage derived foam cell differentiation
small molecule metabolic process - Gene Ontology Biological Process:
- defense response to Gram-positive bacterium
glycerophospholipid biosynthetic process
lipid catabolic process
low-density lipoprotein particle remodeling
phosphatidic acid biosynthetic process
phosphatidic acid metabolic process
phosphatidylcholine acyl-chain remodeling
phosphatidylethanolamine acyl-chain remodeling
phosphatidylglycerol acyl-chain remodeling
phosphatidylinositol acyl-chain remodeling
phosphatidylserine acyl-chain remodeling
phospholipid metabolic process
positive regulation of ERK1 and ERK2 cascade
positive regulation of inflammatory response
positive regulation of macrophage derived foam cell differentiation
small molecule metabolic process - Gene Ontology Molecular Function:
- calcium-dependent phospholipase A2 activity
calcium ion binding
phospholipase A2 activity
phospholipid binding - Gene Ontology Cellular Component:
- endoplasmic reticulum
endoplasmic reticulum membrane
extracellular exosome
extracellular region
extracellular space
perinuclear region of cytoplasm
secretory granule - Keywords:
- 3D-structure
Calcium
Complete proteome
Direct protein sequencing
Disulfide bond
Hydrolase
Lipid degradation
Lipid metabolism
Membrane
Metal-binding
Polymorphism
Reference proteome
Signal