Names & Taxonomy
- Uniprot ID:
- P10826
- Entry Name:
- RARB_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinoic acid receptor beta (RAR-beta) (HBV-activated protein) (Nuclear receptor subfamily 1 group B member 2) (RAR-epsilon)
- Gene Names:
- RARB HAP NR1B2
- Gene Names Primary:
- RARB
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 455
- Sequence:
- MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform Beta-1: Nucleus.; Isoform Beta-2: Nucleus.; Isoform Beta-4: Cytoplasm.
Function
- Function:
- Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function.
- Cross Reference Drug Bank:
- DB00459 DB00210 DB00523 DB04942 DB00799
- Gene Ontology Go:
- cytoplasm
nucleoplasm
nucleus
DNA binding
drug binding
retinoic acid receptor activity
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
zinc ion binding
embryonic digestive tract development
embryonic eye morphogenesis
embryonic hindlimb morphogenesis
gene expression
glandular epithelial cell development
growth plate cartilage development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chondrocyte differentiation
negative regulation of transcription from RNA polymerase II promoter
outflow tract septum morphogenesis
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of neuron differentiation
positive regulation of transcription from RNA polymerase II promoter
regulation of myelination
retinal pigment epithelium development
signal transduction
striatum development
transcription initiation from RNA polymerase II promoter
ureteric bud development
ventricular cardiac muscle cell differentiation - Gene Ontology Biological Process:
- embryonic digestive tract development
embryonic eye morphogenesis
embryonic hindlimb morphogenesis
gene expression
glandular epithelial cell development
growth plate cartilage development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cell proliferation
negative regulation of chondrocyte differentiation
negative regulation of transcription from RNA polymerase II promoter
outflow tract septum morphogenesis
positive regulation of apoptotic process
positive regulation of cell proliferation
positive regulation of neuron differentiation
positive regulation of transcription from RNA polymerase II promoter
regulation of myelination
retinal pigment epithelium development
signal transduction
striatum development
transcription initiation from RNA polymerase II promoter
ureteric bud development
ventricular cardiac muscle cell differentiation - Gene Ontology Molecular Function:
- DNA binding
drug binding
retinoic acid receptor activity
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
zinc ion binding - Gene Ontology Cellular Component:
- cytoplasm
nucleoplasm
nucleus - Keywords:
- 3D-structure
Alternative splicing
Complete proteome
Cytoplasm
DNA-binding
Disease mutation
Metal-binding
Microphthalmia
Nucleus
Phosphoprotein
Polymorphism
Proto-oncogene
Receptor
Reference proteome
Transcription
Transcription regulation
Zinc
Zinc-finger - Interacts With:
- P03255; A4D127; Q5STP9; P48443