Names & Taxonomy
- Uniprot ID:
- P10276
- Entry Name:
- RARA_HUMAN
- Status:
- reviewed
- Protein Names:
- Retinoic acid receptor alpha (RAR-alpha) (Nuclear receptor subfamily 1 group B member 1)
- Gene Names:
- RARA NR1B1
- Gene Names Primary:
- RARA
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 462
- Sequence:
- MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Nucleus. Cytoplasm. Note=Nuclear localization depends on ligand binding, phosphorylation and sumoylation. Transloaction to the nucleus in the absence of ligand is dependent on activation of PKC and the downstream MAPK phosphorylation.
Function
- Function:
- Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone acetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Has a role in the survival of early spermatocytes at the beginning prophase of meiosis. In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function (By similarity). Regulates expression of target genes in a ligand-dependent manner by recruiting chromatin complexes containing KMT2E/MLL5. Mediates retinoic acid-induced granulopoiesis.
- Cross Reference Drug Bank:
- DB00459 DB00210 DB00523 DB00982 DB04942 DB00799
- Gene Ontology Go:
- actin cytoskeleton
cell surface
cytoplasm
dendrite
neuronal cell body
nuclear chromatin
nucleoplasm
nucleus
perinuclear region of cytoplasm
alpha-actinin binding
chromatin DNA binding
drug binding
enzyme binding
mRNA 5'-UTR binding
protein domain specific binding
protein heterodimerization activity
protein kinase A binding
protein kinase B binding
receptor binding
retinoic acid binding
retinoic acid receptor activity
retinoic acid-responsive element binding
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
transcription coactivator activity
transcription corepressor activity
transcription factor activity, sequence-specific DNA binding
transcription factor binding
translation repressor activity, nucleic acid binding
zinc ion binding
apoptotic cell clearance
cellular response to estrogen stimulus
cellular response to lipopolysaccharide
cellular response to retinoic acid
chondroblast differentiation
embryonic camera-type eye development
face development
female pregnancy
gene expression
germ cell development
glandular epithelial cell development
growth plate cartilage development
hippocampus development
limb development
liver development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cartilage development
negative regulation of cell proliferation
negative regulation of granulocyte differentiation
negative regulation of interferon-gamma production
negative regulation of transcription from RNA polymerase II promoter
negative regulation of transcription, DNA-templated
negative regulation of translational initiation
negative regulation of tumor necrosis factor production
neural tube closure
outflow tract septum morphogenesis
positive regulation of binding
positive regulation of cell cycle
positive regulation of cell proliferation
positive regulation of interleukin-13 production
positive regulation of interleukin-4 production
positive regulation of interleukin-5 production
positive regulation of neuron differentiation
positive regulation of T-helper 2 cell differentiation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription, DNA-templated
prostate gland development
protein phosphorylation
regulation of myelination
regulation of synaptic plasticity
response to cytokine
response to estradiol
response to ethanol
response to retinoic acid
response to vitamin A
retinoic acid receptor signaling pathway
Sertoli cell fate commitment
signal transduction
spermatogenesis
trachea cartilage development
transcription initiation from RNA polymerase II promoter
ureteric bud development
ventricular cardiac muscle cell differentiation - Gene Ontology Biological Process:
- apoptotic cell clearance
cellular response to estrogen stimulus
cellular response to lipopolysaccharide
cellular response to retinoic acid
chondroblast differentiation
embryonic camera-type eye development
face development
female pregnancy
gene expression
germ cell development
glandular epithelial cell development
growth plate cartilage development
hippocampus development
limb development
liver development
multicellular organism growth
negative regulation of apoptotic process
negative regulation of cartilage development
negative regulation of cell proliferation
negative regulation of granulocyte differentiation
negative regulation of interferon-gamma production
negative regulation of transcription, DNA-templated
negative regulation of transcription from RNA polymerase II promoter
negative regulation of translational initiation
negative regulation of tumor necrosis factor production
neural tube closure
outflow tract septum morphogenesis
positive regulation of binding
positive regulation of cell cycle
positive regulation of cell proliferation
positive regulation of interleukin-13 production
positive regulation of interleukin-4 production
positive regulation of interleukin-5 production
positive regulation of neuron differentiation
positive regulation of T-helper 2 cell differentiation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
prostate gland development
protein phosphorylation
regulation of myelination
regulation of synaptic plasticity
response to cytokine
response to estradiol
response to ethanol
response to retinoic acid
response to vitamin A
retinoic acid receptor signaling pathway
Sertoli cell fate commitment
signal transduction
spermatogenesis
trachea cartilage development
transcription initiation from RNA polymerase II promoter
ureteric bud development
ventricular cardiac muscle cell differentiation - Gene Ontology Molecular Function:
- alpha-actinin binding
chromatin DNA binding
drug binding
enzyme binding
mRNA 5'-UTR binding
protein domain specific binding
protein heterodimerization activity
protein kinase A binding
protein kinase B binding
receptor binding
retinoic acid binding
retinoic acid receptor activity
retinoic acid-responsive element binding
RNA polymerase II regulatory region sequence-specific DNA binding
steroid hormone receptor activity
transcription coactivator activity
transcription corepressor activity
transcription factor activity, sequence-specific DNA binding
transcription factor binding
translation repressor activity, nucleic acid binding
zinc ion binding - Gene Ontology Cellular Component:
- actin cytoskeleton
cell surface
cytoplasm
dendrite
neuronal cell body
nuclear chromatin
nucleoplasm
nucleus
perinuclear region of cytoplasm - Keywords:
- 3D-structure
Alternative splicing
Chromosomal rearrangement
Complete proteome
Cytoplasm
DNA-binding
Isopeptide bond
Metal-binding
Nucleus
Phosphoprotein
Proto-oncogene
Receptor
Reference proteome
Transcription
Transcription regulation
Ubl conjugation
Zinc
Zinc-finger - Interacts With:
- P59598; Q15910; P50148; Q9UKP3; Q15648; Q71SY5; Q15788; Q9Y6Q9; O75376; P48552; Q9UPP1-2; P78527; P19793; P28702; P48443; Q96EB6; P63165; Q8WW24; Q2M1K9