Names & Taxonomy
- Uniprot ID:
- P0DJI8
- Entry Name:
- SAA1_HUMAN
- Status:
- reviewed
- Protein Names:
- Serum amyloid A-1 protein (SAA) [Cleaved into: Amyloid protein A (Amyloid fibril protein AA); Serum amyloid protein A(2-104); Serum amyloid protein A(3-104); Serum amyloid protein A(2-103); Serum amyloid protein A(2-102); Serum amyloid protein A(4-101)]
- Gene Names:
- SAA1
- Gene Names Primary:
- SAA1
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 122
- Sequence:
- MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted
Function
- Function:
- Major acute phase protein.
- Cross Reference Drug Bank:
- DB00062 DB00064
- Gene Ontology Go:
- cytoplasmic microtubule
endocytic vesicle lumen
extracellular exosome
extracellular region
extracellular space
high-density lipoprotein particle
chemoattractant activity
G-protein coupled receptor binding
heparin binding
activation of MAPK activity
acute-phase response
cellular protein metabolic process
innate immune response
lymphocyte chemotaxis
macrophage chemotaxis
negative regulation of inflammatory response
neutrophil chemotaxis
platelet activation
positive chemotaxis
positive regulation of cell adhesion
positive regulation of cytokine secretion
positive regulation of cytosolic calcium ion concentration
positive regulation of interleukin-1 secretion
receptor-mediated endocytosis
regulation of protein secretion - Gene Ontology Biological Process:
- activation of MAPK activity
acute-phase response
cellular protein metabolic process
innate immune response
lymphocyte chemotaxis
macrophage chemotaxis
negative regulation of inflammatory response
neutrophil chemotaxis
platelet activation
positive chemotaxis
positive regulation of cell adhesion
positive regulation of cytokine secretion
positive regulation of cytosolic calcium ion concentration
positive regulation of interleukin-1 secretion
receptor-mediated endocytosis
regulation of protein secretion - Gene Ontology Molecular Function:
- chemoattractant activity
G-protein coupled receptor binding
heparin binding - Gene Ontology Cellular Component:
- cytoplasmic microtubule
endocytic vesicle lumen
extracellular exosome
extracellular region
extracellular space
high-density lipoprotein particle - Keywords:
- 3D-structure
Acute phase
Amyloid
Amyloidosis
Complete proteome
Direct protein sequencing
HDL
Heparin-binding
Methylation
Polymorphism
Reference proteome
Secreted
Signal