Names & Taxonomy
- Uniprot ID:
- P08887
- Entry Name:
- IL6RA_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)
- Gene Names:
- IL6R
- Gene Names Primary:
- IL6R
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 468
- Sequence:
- MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein.; Isoform 2: Secreted.
Function
- Function:
- Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.; Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.
- Cross Reference Drug Bank:
- DB06273
- Gene Ontology Go:
- apical plasma membrane
basolateral plasma membrane
cell surface
ciliary neurotrophic factor receptor complex
extracellular region
extracellular space
interleukin-6 receptor complex
plasma membrane
ciliary neurotrophic factor binding
enzyme binding
interleukin-6 binding
interleukin-6 receptor activity
protein homodimerization activity
acute-phase response
ciliary neurotrophic factor-mediated signaling pathway
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
endocrine pancreas development
extrinsic apoptotic signaling pathway
hepatic immune response
interleukin-6-mediated signaling pathway
monocyte chemotaxis
negative regulation of collagen biosynthetic process
negative regulation of interleukin-8 production
neutrophil mediated immunity
positive regulation of activation of Janus kinase activity
positive regulation of cell proliferation
positive regulation of chemokine production
positive regulation of interleukin-6 production
positive regulation of leukocyte chemotaxis
positive regulation of MAPK cascade
positive regulation of osteoblast differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of smooth muscle cell proliferation
positive regulation of tyrosine phosphorylation of Stat3 protein
response to cytokine - Gene Ontology Biological Process:
- acute-phase response
ciliary neurotrophic factor-mediated signaling pathway
cytokine-mediated signaling pathway
defense response to Gram-negative bacterium
defense response to Gram-positive bacterium
endocrine pancreas development
extrinsic apoptotic signaling pathway
hepatic immune response
interleukin-6-mediated signaling pathway
monocyte chemotaxis
negative regulation of collagen biosynthetic process
negative regulation of interleukin-8 production
neutrophil mediated immunity
positive regulation of activation of Janus kinase activity
positive regulation of cell proliferation
positive regulation of chemokine production
positive regulation of interleukin-6 production
positive regulation of leukocyte chemotaxis
positive regulation of MAPK cascade
positive regulation of osteoblast differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of smooth muscle cell proliferation
positive regulation of tyrosine phosphorylation of Stat3 protein
response to cytokine - Gene Ontology Molecular Function:
- ciliary neurotrophic factor binding
enzyme binding
interleukin-6 binding
interleukin-6 receptor activity
protein homodimerization activity - Gene Ontology Cellular Component:
- apical plasma membrane
basolateral plasma membrane
cell surface
ciliary neurotrophic factor receptor complex
extracellular region
extracellular space
interleukin-6 receptor complex
plasma membrane - Keywords:
- 3D-structure
Alternative splicing
Cell membrane
Complete proteome
Direct protein sequencing
Disulfide bond
Glycoprotein
Immunoglobulin domain
Membrane
Polymorphism
Receptor
Reference proteome
Repeat
Secreted
Signal
Transmembrane
Transmembrane helix - Interacts With:
- P05231; Q2HRC7