Names & Taxonomy
- Uniprot ID:
- P08700
- Entry Name:
- IL3_HUMAN
- Status:
- reviewed
- Protein Names:
- Interleukin-3 (IL-3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony-stimulating factor) (P-cell-stimulating factor)
- Gene Names:
- IL3
- Gene Names Primary:
- IL3
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 152
- Sequence:
- MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Secreted.
Function
- Function:
- Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
- Cross Reference Drug Bank:
- DB01025
- Gene Ontology Go:
- extracellular region
extracellular space
intracellular
cytokine activity
interleukin-3 receptor binding
activation of MAPKK activity
axon guidance
cell-cell signaling
cytokine-mediated signaling pathway
embryonic hemopoiesis
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
MAPK cascade
nervous system development
neurotrophin TRK receptor signaling pathway
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of mast cell proliferation
positive regulation of myeloid leukocyte differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of tyrosine phosphorylation of Stat5 protein
Ras protein signal transduction
small GTPase mediated signal transduction
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Biological Process:
- activation of MAPKK activity
axon guidance
cell-cell signaling
cytokine-mediated signaling pathway
embryonic hemopoiesis
epidermal growth factor receptor signaling pathway
Fc-epsilon receptor signaling pathway
fibroblast growth factor receptor signaling pathway
innate immune response
insulin receptor signaling pathway
MAPK cascade
nervous system development
neurotrophin TRK receptor signaling pathway
positive regulation of cell proliferation
positive regulation of DNA replication
positive regulation of mast cell proliferation
positive regulation of myeloid leukocyte differentiation
positive regulation of peptidyl-tyrosine phosphorylation
positive regulation of tyrosine phosphorylation of Stat5 protein
Ras protein signal transduction
small GTPase mediated signal transduction
vascular endothelial growth factor receptor signaling pathway - Gene Ontology Molecular Function:
- cytokine activity
interleukin-3 receptor binding - Gene Ontology Cellular Component:
- extracellular region
extracellular space
intracellular - Keywords:
- 3D-structure
Complete proteome
Cytokine
Disulfide bond
Glycoprotein
Growth factor
Polymorphism
Reference proteome
Secreted
Signal - Interacts With:
- P32927