Names & Taxonomy
- Uniprot ID:
- P05981
- Entry Name:
- HEPS_HUMAN
- Status:
- reviewed
- Protein Names:
- Serine protease hepsin (EC 3.4.21.106) (Transmembrane protease serine 1) [Cleaved into: Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain]
- Gene Names:
- HPN TMPRSS1
- Gene Names Primary:
- HPN
- Organism:
- Homo sapiens (Human)
Structure
- Length:
- 417
- Sequence:
- MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
- Proteomes:
- UP000005640
Subcellular location
- Subcellular Location:
- Cell membrane
Function
- Function:
- Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL (PubMed:21875933, PubMed:15839837). Plays a role in cell growth and maintenance of cell morphology (PubMed:8346233, PubMed:21875933). Plays a role in the proteolytic processing of ACE2 (PubMed:24227843). Mediates the proteolytic cleavage of urinary UMOD that is required for UMOD polymerization (PubMed:26673890).
- Catalytic Activity:
- Cleavage after basic amino-acid residues, with Arg strongly preferred to Lys.
- Active Site:
- ACT_SITE 203 203 Charge relay system.
- Cross Reference Drug Bank:
- DB00036
- Gene Ontology Go:
- apical plasma membrane
cell surface
cell-cell junction
endoplasmic reticulum membrane
extracellular exosome
integral component of membrane
integral component of plasma membrane
neuronal cell body
plasma membrane
calcium-activated potassium channel activity
peptidase activity
serine-type endopeptidase activity
serine-type exopeptidase activity
serine-type peptidase activity
basement membrane disassembly
cochlea morphogenesis
detection of mechanical stimulus involved in sensory perception of sound
negative regulation of apoptotic process
negative regulation of epithelial cell proliferation
negative regulation of epithelial to mesenchymal transition
pilomotor reflex
positive regulation by host of viral transcription
positive regulation of cell growth
positive regulation of gene expression
positive regulation of hepatocyte proliferation
positive regulation of plasminogen activation
positive regulation of thyroid hormone generation
potassium ion transmembrane transport
proteolysis
regulation of cell shape
response to thyroid hormone - Gene Ontology Biological Process:
- basement membrane disassembly
cochlea morphogenesis
detection of mechanical stimulus involved in sensory perception of sound
negative regulation of apoptotic process
negative regulation of epithelial cell proliferation
negative regulation of epithelial to mesenchymal transition
pilomotor reflex
positive regulation by host of viral transcription
positive regulation of cell growth
positive regulation of gene expression
positive regulation of hepatocyte proliferation
positive regulation of plasminogen activation
positive regulation of thyroid hormone generation
potassium ion transmembrane transport
proteolysis
regulation of cell shape
response to thyroid hormone - Gene Ontology Molecular Function:
- calcium-activated potassium channel activity
peptidase activity
serine-type endopeptidase activity
serine-type exopeptidase activity
serine-type peptidase activity - Gene Ontology Cellular Component:
- apical plasma membrane
cell-cell junction
cell surface
endoplasmic reticulum membrane
extracellular exosome
integral component of membrane
integral component of plasma membrane
neuronal cell body
plasma membrane - Keywords:
- 3D-structure
Cell membrane
Complete proteome
Disulfide bond
Glycoprotein
Hydrolase
Membrane
Protease
Reference proteome
Serine protease
Signal-anchor
Transmembrane
Transmembrane helix